Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8LR47

Protein Details
Accession J8LR47   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MASLPHPKIVKKHTKKFKRHHSDRYHRVSENBasic
NLS Segment(s)
PositionSequence
8-27KIVKKHTKKFKRHHSDRYHR
Subcellular Location(s) nucl 12.5, mito_nucl 12, mito 10.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MASLPHPKIVKKHTKKFKRHHSDRYHRVSENWRKQKGIDSVVRRRFRGNISEPKIGYGSNKKTKFLSPSGHNTFLVANVKDLETLTMHTKTYAAEIAHNISAKNRVVILARAKALGIKVTNPKGRLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.88
3 0.91
4 0.92
5 0.92
6 0.92
7 0.92
8 0.92
9 0.93
10 0.92
11 0.91
12 0.86
13 0.76
14 0.71
15 0.71
16 0.71
17 0.71
18 0.7
19 0.64
20 0.59
21 0.58
22 0.61
23 0.57
24 0.53
25 0.5
26 0.49
27 0.56
28 0.64
29 0.67
30 0.6
31 0.56
32 0.52
33 0.47
34 0.47
35 0.44
36 0.45
37 0.47
38 0.51
39 0.49
40 0.47
41 0.44
42 0.35
43 0.31
44 0.28
45 0.31
46 0.35
47 0.36
48 0.36
49 0.37
50 0.4
51 0.41
52 0.38
53 0.35
54 0.31
55 0.38
56 0.42
57 0.43
58 0.4
59 0.36
60 0.31
61 0.28
62 0.27
63 0.18
64 0.14
65 0.12
66 0.12
67 0.12
68 0.12
69 0.1
70 0.07
71 0.08
72 0.11
73 0.12
74 0.12
75 0.12
76 0.12
77 0.12
78 0.13
79 0.14
80 0.11
81 0.12
82 0.13
83 0.16
84 0.17
85 0.18
86 0.16
87 0.15
88 0.19
89 0.18
90 0.17
91 0.15
92 0.15
93 0.16
94 0.21
95 0.26
96 0.26
97 0.26
98 0.25
99 0.25
100 0.25
101 0.24
102 0.24
103 0.19
104 0.2
105 0.28
106 0.36
107 0.42
108 0.41
109 0.43
110 0.42