FuNGI

A0A4Q4XUD7

Protein Details

Accession

A0A4Q4XUD7

Localization Confidence

Low

Confidence Score

8.6

NoLS Segment(s)

Position	Sequence	Protein Nature
62-81	NSNSNPPKRQRANSDRQSVV	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 12.5, mito 10, cyto_nucl 8.5, cyto 3.5

Family & Domain DBs

InterPro	View protein in InterPro IPR041723 CCT IPR004821 Cyt_trans-like IPR045049 Pcy1-like IPR014729 Rossmann-like_a/b/a_fold
Gene Ontology	GO:0004105 F:choline-phosphate cytidylyltransferase activity
Pfam	View protein in Pfam PF01467 CTP_transf_like
CDD	cd02174 CCT

Amino Acid Sequences

MTSPSSSSHAGKRKRPTTANSTIMDDNPLLQPSSRDASGEEGDTTAPESGKLSHRKADTAANSNSNPPKRQRANSDRQSVVETNTDHAVDPGEPSDTTEASIDIADRVGKKTRRSAASKDIAMQDDEDKKQQTAMAPPPVGNLTHPAGYKTNPPPAGRTVRVYADGVFDLFHLGHMRQLEQAKKAFPDVYLIVGVTGDEETHKRKGLTVLSGKERAETLRHCKWVDEVIEDCPWIVTPDFLEKHKIDYVAHDDLPYGAAEGDDIYAPIKKAGKFLVTQRTEGVSTTGIITKIVRDYEKYIARQLKRGTSRQELNVSWLKKNELDLKRHVQEIRDNIRANWTTTGQELTRELRQYWPASRPQSPAPLRGAVPSTPVPNGAKSPTTPAGERAPNDFMTGYTLGLIGGVRSWMTKSRQNVRDSRPPSDEDSDESDSKPSEQRGRPVASGS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.73
2	0.76
3	0.75
4	0.75
5	0.77
6	0.75
7	0.67
8	0.64
9	0.57
10	0.5
11	0.45
12	0.36
13	0.28
14	0.23
15	0.22
16	0.18
17	0.16
18	0.17
19	0.18
20	0.23
21	0.21
22	0.19
23	0.18
24	0.23
25	0.24
26	0.24
27	0.2
28	0.16
29	0.16
30	0.16
31	0.16
32	0.13
33	0.11
34	0.1
35	0.1
36	0.13
37	0.22
38	0.3
39	0.32
40	0.37
41	0.39
42	0.41
43	0.42
44	0.47
45	0.45
46	0.45
47	0.46
48	0.45
49	0.45
50	0.5
51	0.56
52	0.53
53	0.52
54	0.5
55	0.56
56	0.59
57	0.65
58	0.69
59	0.71
60	0.76
61	0.8
62	0.82
63	0.74
64	0.67
65	0.65
66	0.56
67	0.47
68	0.41
69	0.33
70	0.26
71	0.26
72	0.25
73	0.19
74	0.18
75	0.17
76	0.12
77	0.12
78	0.11
79	0.11
80	0.1
81	0.11
82	0.13
83	0.12
84	0.12
85	0.11
86	0.11
87	0.1
88	0.1
89	0.09
90	0.07
91	0.07
92	0.09
93	0.1
94	0.13
95	0.2
96	0.25
97	0.29
98	0.37
99	0.44
100	0.5
101	0.54
102	0.58
103	0.6
104	0.63
105	0.6
106	0.55
107	0.51
108	0.44
109	0.39
110	0.34
111	0.29
112	0.27
113	0.27
114	0.26
115	0.24
116	0.23
117	0.23
118	0.24
119	0.22
120	0.23
121	0.28
122	0.31
123	0.3
124	0.3
125	0.31
126	0.3
127	0.27
128	0.21
129	0.18
130	0.14
131	0.16
132	0.16
133	0.17
134	0.17
135	0.18
136	0.26
137	0.26
138	0.32
139	0.33
140	0.34
141	0.34
142	0.39
143	0.45
144	0.39
145	0.38
146	0.34
147	0.31
148	0.32
149	0.3
150	0.24
151	0.19
152	0.17
153	0.13
154	0.11
155	0.09
156	0.08
157	0.07
158	0.07
159	0.07
160	0.06
161	0.08
162	0.09
163	0.09
164	0.13
165	0.17
166	0.19
167	0.21
168	0.23
169	0.23
170	0.23
171	0.24
172	0.21
173	0.17
174	0.17
175	0.14
176	0.13
177	0.12
178	0.11
179	0.09
180	0.08
181	0.08
182	0.05
183	0.05
184	0.03
185	0.04
186	0.06
187	0.09
188	0.11
189	0.12
190	0.12
191	0.14
192	0.18
193	0.19
194	0.25
195	0.27
196	0.3
197	0.32
198	0.36
199	0.34
200	0.31
201	0.29
202	0.23
203	0.2
204	0.2
205	0.23
206	0.26
207	0.3
208	0.29
209	0.29
210	0.29
211	0.3
212	0.27
213	0.22
214	0.18
215	0.16
216	0.16
217	0.16
218	0.14
219	0.1
220	0.09
221	0.08
222	0.06
223	0.04
224	0.05
225	0.1
226	0.12
227	0.13
228	0.17
229	0.17
230	0.2
231	0.21
232	0.22
233	0.16
234	0.18
235	0.23
236	0.22
237	0.22
238	0.19
239	0.17
240	0.16
241	0.16
242	0.13
243	0.08
244	0.05
245	0.04
246	0.04
247	0.04
248	0.04
249	0.04
250	0.04
251	0.04
252	0.05
253	0.05
254	0.08
255	0.11
256	0.12
257	0.14
258	0.15
259	0.17
260	0.19
261	0.25
262	0.33
263	0.31
264	0.32
265	0.31
266	0.31
267	0.29
268	0.27
269	0.22
270	0.12
271	0.1
272	0.11
273	0.11
274	0.1
275	0.1
276	0.1
277	0.1
278	0.11
279	0.13
280	0.13
281	0.13
282	0.16
283	0.23
284	0.28
285	0.28
286	0.34
287	0.4
288	0.41
289	0.45
290	0.45
291	0.47
292	0.49
293	0.53
294	0.52
295	0.52
296	0.55
297	0.53
298	0.55
299	0.47
300	0.46
301	0.47
302	0.44
303	0.38
304	0.35
305	0.32
306	0.28
307	0.32
308	0.36
309	0.36
310	0.39
311	0.43
312	0.49
313	0.49
314	0.53
315	0.5
316	0.43
317	0.43
318	0.48
319	0.47
320	0.46
321	0.45
322	0.4
323	0.47
324	0.45
325	0.41
326	0.34
327	0.29
328	0.23
329	0.23
330	0.26
331	0.18
332	0.19
333	0.19
334	0.2
335	0.23
336	0.24
337	0.24
338	0.26
339	0.31
340	0.33
341	0.35
342	0.38
343	0.41
344	0.44
345	0.48
346	0.47
347	0.46
348	0.52
349	0.5
350	0.5
351	0.46
352	0.44
353	0.4
354	0.39
355	0.37
356	0.28
357	0.29
358	0.26
359	0.24
360	0.21
361	0.25
362	0.23
363	0.23
364	0.25
365	0.24
366	0.24
367	0.23
368	0.29
369	0.31
370	0.32
371	0.31
372	0.32
373	0.36
374	0.39
375	0.4
376	0.37
377	0.36
378	0.33
379	0.33
380	0.3
381	0.23
382	0.22
383	0.21
384	0.16
385	0.12
386	0.12
387	0.1
388	0.1
389	0.1
390	0.05
391	0.05
392	0.06
393	0.06
394	0.07
395	0.09
396	0.15
397	0.2
398	0.26
399	0.35
400	0.45
401	0.52
402	0.59
403	0.67
404	0.69
405	0.74
406	0.74
407	0.72
408	0.67
409	0.63
410	0.61
411	0.58
412	0.51
413	0.45
414	0.46
415	0.45
416	0.41
417	0.39
418	0.34
419	0.3
420	0.31
421	0.32
422	0.32
423	0.37
424	0.41
425	0.48
426	0.54
427	0.58

A0A4Q4XUD7

3D AlphaFold-predicted Structure Viewer