Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4YU79

Protein Details
Accession A0A4Q4YU79    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-68LWISKFLSKRKAKKQAMAAHAHydrophilic
NLS Segment(s)
PositionSequence
58-58K
Subcellular Location(s) plas 10, E.R. 6, mito 4, cyto 3, golg 2, mito_nucl 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPAINNAAIVARDTFSTLAKRENWASQEAGVVVVFCIVFLVGCGLIGLWISKFLSKRKAKKQAMAAHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.15
4 0.15
5 0.18
6 0.19
7 0.22
8 0.24
9 0.27
10 0.27
11 0.26
12 0.25
13 0.21
14 0.2
15 0.17
16 0.15
17 0.1
18 0.08
19 0.05
20 0.05
21 0.04
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.03
36 0.05
37 0.05
38 0.09
39 0.12
40 0.17
41 0.27
42 0.36
43 0.46
44 0.56
45 0.67
46 0.72
47 0.77
48 0.82