Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8Q3R4

Protein Details
Accession J8Q3R4   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-28IQKVGNKDLSRKDKRRFNIESKVNKIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013907  Sds3  
Gene Ontology GO:0005654  C:nucleoplasm  
Pfam View protein in Pfam  
PF08598  Sds3  
Amino Acid Sequences MAIQKVGNKDLSRKDKRRFNIESKVNKIYQNFYLERDNQYKDRLTALQTDLTSLHQGDNGQYARQVRDLEEERDIELVRLRLFEEYRVSRSGIEFQEDIEKAKAEHEKLIKLCKERLYSSIEQKIKKLQEERLLMDVANVHSYAMNYSRPQYQKNTRSHTVSGWDSSSNEYGRDTANESATDTGAGNDRRTLRRRNASKEVRGNNNNQEDSDFQTGNGSGNNGQGSRQGSQFPHFNSQPYKSGMVSDSDFLQGINEGTDLYAFLFGEESPKDNANGNEKKKNRGAQRYSTKTAPPLQSLKPDEVTEDISLIRELTGQPPAPFKLRSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.76
3 0.81
4 0.84
5 0.83
6 0.81
7 0.81
8 0.81
9 0.82
10 0.79
11 0.79
12 0.72
13 0.67
14 0.61
15 0.55
16 0.51
17 0.49
18 0.43
19 0.39
20 0.44
21 0.43
22 0.46
23 0.47
24 0.47
25 0.42
26 0.45
27 0.45
28 0.39
29 0.4
30 0.35
31 0.32
32 0.33
33 0.33
34 0.33
35 0.29
36 0.3
37 0.26
38 0.25
39 0.24
40 0.19
41 0.16
42 0.13
43 0.14
44 0.14
45 0.19
46 0.19
47 0.17
48 0.19
49 0.21
50 0.21
51 0.24
52 0.24
53 0.19
54 0.26
55 0.29
56 0.3
57 0.3
58 0.29
59 0.27
60 0.27
61 0.26
62 0.19
63 0.18
64 0.16
65 0.13
66 0.13
67 0.13
68 0.15
69 0.15
70 0.17
71 0.21
72 0.22
73 0.25
74 0.26
75 0.26
76 0.24
77 0.25
78 0.29
79 0.23
80 0.23
81 0.2
82 0.19
83 0.25
84 0.24
85 0.24
86 0.19
87 0.18
88 0.15
89 0.19
90 0.23
91 0.17
92 0.23
93 0.24
94 0.28
95 0.3
96 0.37
97 0.37
98 0.37
99 0.4
100 0.4
101 0.4
102 0.37
103 0.38
104 0.38
105 0.38
106 0.42
107 0.46
108 0.45
109 0.43
110 0.43
111 0.47
112 0.43
113 0.44
114 0.41
115 0.38
116 0.41
117 0.43
118 0.44
119 0.39
120 0.36
121 0.3
122 0.26
123 0.22
124 0.14
125 0.11
126 0.09
127 0.07
128 0.07
129 0.07
130 0.08
131 0.08
132 0.09
133 0.09
134 0.11
135 0.17
136 0.19
137 0.22
138 0.28
139 0.36
140 0.43
141 0.5
142 0.56
143 0.53
144 0.55
145 0.53
146 0.47
147 0.42
148 0.34
149 0.28
150 0.22
151 0.19
152 0.15
153 0.16
154 0.17
155 0.12
156 0.11
157 0.1
158 0.1
159 0.1
160 0.1
161 0.11
162 0.11
163 0.11
164 0.11
165 0.12
166 0.11
167 0.11
168 0.1
169 0.08
170 0.07
171 0.1
172 0.11
173 0.11
174 0.14
175 0.18
176 0.23
177 0.28
178 0.34
179 0.38
180 0.47
181 0.54
182 0.59
183 0.66
184 0.68
185 0.72
186 0.74
187 0.72
188 0.71
189 0.68
190 0.65
191 0.63
192 0.61
193 0.53
194 0.44
195 0.39
196 0.32
197 0.32
198 0.3
199 0.22
200 0.16
201 0.17
202 0.17
203 0.16
204 0.15
205 0.11
206 0.08
207 0.1
208 0.11
209 0.1
210 0.1
211 0.13
212 0.15
213 0.16
214 0.16
215 0.18
216 0.19
217 0.22
218 0.26
219 0.26
220 0.31
221 0.3
222 0.33
223 0.34
224 0.36
225 0.37
226 0.36
227 0.34
228 0.27
229 0.29
230 0.26
231 0.24
232 0.22
233 0.18
234 0.16
235 0.15
236 0.14
237 0.12
238 0.11
239 0.09
240 0.08
241 0.07
242 0.06
243 0.05
244 0.05
245 0.05
246 0.05
247 0.05
248 0.06
249 0.05
250 0.05
251 0.06
252 0.06
253 0.09
254 0.1
255 0.12
256 0.13
257 0.14
258 0.15
259 0.19
260 0.22
261 0.29
262 0.37
263 0.42
264 0.5
265 0.52
266 0.59
267 0.63
268 0.67
269 0.68
270 0.7
271 0.71
272 0.71
273 0.79
274 0.8
275 0.78
276 0.74
277 0.68
278 0.62
279 0.63
280 0.57
281 0.52
282 0.5
283 0.49
284 0.53
285 0.54
286 0.53
287 0.48
288 0.43
289 0.39
290 0.35
291 0.34
292 0.26
293 0.23
294 0.18
295 0.16
296 0.16
297 0.14
298 0.12
299 0.1
300 0.11
301 0.13
302 0.19
303 0.21
304 0.22
305 0.27
306 0.3
307 0.33