Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4VVV3

Protein Details
Accession A0A4Q4VVV3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
491-512AGPSDTYRTRERRRSRTAAEGCHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 9.166, mito 9, cyto 9, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033010  Cdc20/Fizzy  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR036322  WD40_repeat_dom_sf  
Gene Ontology GO:0010997  F:anaphase-promoting complex binding  
GO:0097027  F:ubiquitin-protein transferase activator activity  
GO:1904668  P:positive regulation of ubiquitin protein ligase activity  
Amino Acid Sequences MPIPTPSADRFVPIRGTLSLGERFRSSKEPHELSASERLVRTDSSTPDAFISRTRRAEMSVSVGGLAPGGSAIEGARSRLFSPGTHARLYTTSFSKVRPESEEEQEKHEGRLALALKMDRVQRVLDFDSYAKTFPRWRGGSRGRSRIDTTRTTWNGTEWSNDDYVPRAPRDVRALPNAPFKVLDAPGLRDDFYCSIMAYDANCNTLAVGLGNLLYGWSEAAGVTLLNAGLGDGSWLTSVAFSSEQGEKSILAFGRSNGRLSLMSLFEHLLPRFETQQAAPVACLSWRPITTTRGSLNPFSPGTPEVNRHNWPGATTLLAKIKVHSQQICGLAWSHNGEQFATGGNDNLCCLFDHEKIIDGEETTDSRETPACKCVPAGSERHRWQHGAAVKAIAFCPWREGLIATGGGSNDRCIHFFHTSSGAALATIAVAAQVTSLIWSTTRRELAATFGYAQPDHPYRIAVFSWPDCRQVAAVPWEGEHRALFAIPYPAGPSDTYRTRERRRSRTAAEGCIVVASSDESVKFHEVWTAGRKATTGLDSGVLAGSDILEMSEGIDKEGDIIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.27
4 0.25
5 0.28
6 0.31
7 0.29
8 0.3
9 0.3
10 0.31
11 0.32
12 0.37
13 0.37
14 0.39
15 0.47
16 0.48
17 0.48
18 0.53
19 0.5
20 0.47
21 0.52
22 0.45
23 0.38
24 0.35
25 0.34
26 0.3
27 0.3
28 0.3
29 0.26
30 0.27
31 0.29
32 0.29
33 0.28
34 0.28
35 0.29
36 0.25
37 0.27
38 0.31
39 0.32
40 0.35
41 0.37
42 0.36
43 0.37
44 0.4
45 0.36
46 0.35
47 0.29
48 0.26
49 0.24
50 0.23
51 0.2
52 0.16
53 0.13
54 0.06
55 0.04
56 0.04
57 0.03
58 0.04
59 0.04
60 0.08
61 0.08
62 0.1
63 0.12
64 0.13
65 0.14
66 0.18
67 0.19
68 0.16
69 0.23
70 0.31
71 0.33
72 0.33
73 0.33
74 0.31
75 0.32
76 0.35
77 0.33
78 0.26
79 0.28
80 0.29
81 0.3
82 0.36
83 0.36
84 0.36
85 0.36
86 0.4
87 0.39
88 0.46
89 0.54
90 0.48
91 0.51
92 0.54
93 0.5
94 0.44
95 0.43
96 0.35
97 0.25
98 0.3
99 0.26
100 0.21
101 0.23
102 0.22
103 0.19
104 0.22
105 0.25
106 0.2
107 0.2
108 0.2
109 0.18
110 0.22
111 0.24
112 0.21
113 0.2
114 0.19
115 0.21
116 0.21
117 0.2
118 0.17
119 0.17
120 0.21
121 0.24
122 0.33
123 0.33
124 0.35
125 0.45
126 0.53
127 0.61
128 0.65
129 0.69
130 0.63
131 0.63
132 0.65
133 0.62
134 0.58
135 0.52
136 0.47
137 0.48
138 0.47
139 0.46
140 0.42
141 0.37
142 0.34
143 0.3
144 0.29
145 0.21
146 0.22
147 0.19
148 0.19
149 0.18
150 0.16
151 0.2
152 0.2
153 0.19
154 0.2
155 0.2
156 0.23
157 0.3
158 0.33
159 0.33
160 0.36
161 0.39
162 0.39
163 0.46
164 0.44
165 0.37
166 0.32
167 0.29
168 0.26
169 0.23
170 0.24
171 0.17
172 0.19
173 0.2
174 0.21
175 0.2
176 0.16
177 0.19
178 0.15
179 0.15
180 0.13
181 0.11
182 0.1
183 0.1
184 0.11
185 0.09
186 0.11
187 0.1
188 0.11
189 0.11
190 0.1
191 0.1
192 0.09
193 0.08
194 0.05
195 0.05
196 0.04
197 0.04
198 0.04
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.02
217 0.02
218 0.03
219 0.02
220 0.03
221 0.03
222 0.03
223 0.03
224 0.03
225 0.03
226 0.04
227 0.05
228 0.05
229 0.07
230 0.1
231 0.1
232 0.11
233 0.11
234 0.1
235 0.1
236 0.13
237 0.11
238 0.11
239 0.11
240 0.11
241 0.18
242 0.18
243 0.18
244 0.15
245 0.16
246 0.15
247 0.15
248 0.17
249 0.1
250 0.1
251 0.1
252 0.11
253 0.1
254 0.12
255 0.11
256 0.1
257 0.1
258 0.11
259 0.12
260 0.12
261 0.12
262 0.1
263 0.16
264 0.16
265 0.15
266 0.13
267 0.12
268 0.11
269 0.11
270 0.11
271 0.07
272 0.08
273 0.09
274 0.12
275 0.14
276 0.17
277 0.19
278 0.22
279 0.22
280 0.23
281 0.25
282 0.24
283 0.22
284 0.22
285 0.21
286 0.18
287 0.17
288 0.15
289 0.16
290 0.16
291 0.19
292 0.2
293 0.25
294 0.26
295 0.27
296 0.27
297 0.24
298 0.23
299 0.22
300 0.18
301 0.14
302 0.13
303 0.14
304 0.15
305 0.16
306 0.15
307 0.14
308 0.18
309 0.21
310 0.25
311 0.24
312 0.23
313 0.26
314 0.28
315 0.27
316 0.23
317 0.2
318 0.16
319 0.16
320 0.17
321 0.13
322 0.13
323 0.13
324 0.13
325 0.12
326 0.11
327 0.11
328 0.1
329 0.09
330 0.08
331 0.08
332 0.08
333 0.08
334 0.08
335 0.07
336 0.06
337 0.09
338 0.12
339 0.12
340 0.15
341 0.15
342 0.17
343 0.17
344 0.18
345 0.15
346 0.12
347 0.12
348 0.11
349 0.11
350 0.1
351 0.1
352 0.09
353 0.1
354 0.12
355 0.13
356 0.14
357 0.2
358 0.19
359 0.19
360 0.19
361 0.2
362 0.21
363 0.23
364 0.29
365 0.29
366 0.38
367 0.43
368 0.48
369 0.48
370 0.46
371 0.43
372 0.42
373 0.4
374 0.34
375 0.3
376 0.26
377 0.25
378 0.25
379 0.24
380 0.19
381 0.16
382 0.12
383 0.14
384 0.13
385 0.12
386 0.12
387 0.12
388 0.11
389 0.12
390 0.13
391 0.1
392 0.1
393 0.1
394 0.11
395 0.1
396 0.1
397 0.11
398 0.12
399 0.12
400 0.13
401 0.18
402 0.2
403 0.21
404 0.22
405 0.22
406 0.22
407 0.22
408 0.21
409 0.15
410 0.12
411 0.11
412 0.09
413 0.05
414 0.04
415 0.04
416 0.03
417 0.03
418 0.02
419 0.02
420 0.03
421 0.03
422 0.03
423 0.04
424 0.04
425 0.05
426 0.08
427 0.11
428 0.17
429 0.18
430 0.18
431 0.19
432 0.19
433 0.23
434 0.24
435 0.22
436 0.19
437 0.19
438 0.21
439 0.2
440 0.2
441 0.21
442 0.21
443 0.22
444 0.2
445 0.2
446 0.19
447 0.22
448 0.22
449 0.19
450 0.21
451 0.22
452 0.29
453 0.29
454 0.31
455 0.29
456 0.29
457 0.27
458 0.24
459 0.26
460 0.24
461 0.27
462 0.24
463 0.24
464 0.26
465 0.26
466 0.25
467 0.2
468 0.16
469 0.12
470 0.12
471 0.11
472 0.11
473 0.14
474 0.13
475 0.13
476 0.14
477 0.14
478 0.16
479 0.16
480 0.18
481 0.21
482 0.27
483 0.31
484 0.38
485 0.47
486 0.55
487 0.64
488 0.71
489 0.75
490 0.78
491 0.83
492 0.81
493 0.82
494 0.79
495 0.75
496 0.67
497 0.57
498 0.47
499 0.38
500 0.32
501 0.21
502 0.15
503 0.09
504 0.08
505 0.09
506 0.09
507 0.09
508 0.12
509 0.15
510 0.15
511 0.15
512 0.18
513 0.17
514 0.22
515 0.28
516 0.3
517 0.28
518 0.28
519 0.28
520 0.26
521 0.29
522 0.26
523 0.21
524 0.17
525 0.17
526 0.17
527 0.17
528 0.16
529 0.12
530 0.1
531 0.08
532 0.07
533 0.05
534 0.05
535 0.04
536 0.04
537 0.04
538 0.06
539 0.11
540 0.1
541 0.11
542 0.12
543 0.12