Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4VJA8

Protein Details
Accession A0A4Q4VJA8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
33-57HPRPNTPSRRANRPHVRPRQGRGHTBasic
NLS Segment(s)
PositionSequence
45-46RP
92-102PHPPPPPPRRA
Subcellular Location(s) mito 14, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR005996  Ribosomal_L30_bac-type  
IPR018038  Ribosomal_L30_CS  
IPR016082  Ribosomal_L30_ferredoxin-like  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
PROSITE View protein in PROSITE  
PS00634  RIBOSOMAL_L30  
CDD cd01658  Ribosomal_L30  
Amino Acid Sequences MRYTEFIPYRRLDIQAVRGRPVASSEGEEDVAHPRPNTPSRRANRPHVRPRQGRGHTVPSTAALLRRLPTLPPTTNPHPXXXPRRPTIPPTPHPPPPPPRRAREMSYFRITLRRSAIGLPRRTRGVLAALGLRRRTQTVFHPVDAQFAGMIMKVKELVDVEETDRALTTRELRDARRPDPGFWVESAVPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.45
4 0.43
5 0.42
6 0.4
7 0.36
8 0.34
9 0.27
10 0.2
11 0.21
12 0.2
13 0.19
14 0.2
15 0.19
16 0.18
17 0.19
18 0.21
19 0.2
20 0.18
21 0.18
22 0.24
23 0.32
24 0.37
25 0.4
26 0.47
27 0.51
28 0.62
29 0.66
30 0.7
31 0.73
32 0.78
33 0.81
34 0.82
35 0.86
36 0.82
37 0.83
38 0.83
39 0.76
40 0.73
41 0.68
42 0.66
43 0.57
44 0.51
45 0.45
46 0.35
47 0.32
48 0.25
49 0.22
50 0.15
51 0.15
52 0.14
53 0.16
54 0.15
55 0.14
56 0.17
57 0.21
58 0.21
59 0.23
60 0.29
61 0.32
62 0.4
63 0.45
64 0.51
65 0.52
66 0.53
67 0.56
68 0.56
69 0.58
70 0.54
71 0.59
72 0.58
73 0.55
74 0.6
75 0.58
76 0.57
77 0.54
78 0.55
79 0.54
80 0.54
81 0.6
82 0.59
83 0.58
84 0.59
85 0.6
86 0.58
87 0.58
88 0.56
89 0.52
90 0.5
91 0.47
92 0.41
93 0.42
94 0.39
95 0.33
96 0.29
97 0.24
98 0.21
99 0.23
100 0.3
101 0.32
102 0.38
103 0.38
104 0.37
105 0.38
106 0.37
107 0.35
108 0.28
109 0.24
110 0.18
111 0.16
112 0.18
113 0.19
114 0.22
115 0.22
116 0.22
117 0.2
118 0.21
119 0.2
120 0.18
121 0.23
122 0.3
123 0.33
124 0.33
125 0.37
126 0.35
127 0.37
128 0.34
129 0.27
130 0.17
131 0.13
132 0.13
133 0.08
134 0.1
135 0.07
136 0.07
137 0.08
138 0.09
139 0.1
140 0.1
141 0.11
142 0.12
143 0.13
144 0.15
145 0.16
146 0.16
147 0.15
148 0.15
149 0.13
150 0.13
151 0.14
152 0.18
153 0.19
154 0.26
155 0.3
156 0.34
157 0.44
158 0.49
159 0.49
160 0.54
161 0.53
162 0.48
163 0.53
164 0.52
165 0.45
166 0.39
167 0.41