Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4T729

Protein Details
Accession A0A4Q4T729    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-39GEPPLEPPKKRTPGPKKGTPNTAKSCDKHydrophilic
NLS Segment(s)
PositionSequence
19-28PKKRTPGPKK
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
CDD cd00067  GAL4  
Amino Acid Sequences MDYNFVSYGPSGEPPLEPPKKRTPGPKKGTPNTAKSCDKCYKDHRVCTGGRPCDRCKASNWECVTIRHSLKRGPIAGAGTAAERILGALVRVEPGFEQYVIGLLSNRRAPDSEHTLLHMLRDSSAAEQKVFRNAFIRSRLYDQVCPPRQIADSPRAQQTGSLGGAHNPPGPGSRVDYSQMTTSADGVPTAQQDPTTPNVVYTAGQDGEQSGEQRREMTAVSQAPIAQQYTDSTFNGNYTPLAYGEQLPIMASADDILNSLQYDATNVAYNPSDDGEQDREVEAMVDTAITRHCATLNAMYSPLSHSQQPQTMPSADDMQNTQQCAITSDVAHYPVQDAEQRQETATVGHTSAQLYDPFNAIHSPLLNGEQLKATVPTFELPITQPYENSSMYDYDLTYPVHEEDPESILFPGLRSASHYQPAPAPESYNGPSTNPAGEGYSNSEYQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.3
3 0.38
4 0.39
5 0.45
6 0.54
7 0.61
8 0.66
9 0.72
10 0.73
11 0.75
12 0.8
13 0.83
14 0.83
15 0.84
16 0.88
17 0.85
18 0.84
19 0.81
20 0.81
21 0.79
22 0.71
23 0.72
24 0.7
25 0.67
26 0.65
27 0.65
28 0.68
29 0.69
30 0.74
31 0.72
32 0.71
33 0.69
34 0.7
35 0.71
36 0.69
37 0.68
38 0.66
39 0.63
40 0.65
41 0.67
42 0.59
43 0.55
44 0.57
45 0.55
46 0.58
47 0.58
48 0.55
49 0.52
50 0.53
51 0.5
52 0.47
53 0.46
54 0.43
55 0.42
56 0.4
57 0.44
58 0.48
59 0.47
60 0.42
61 0.4
62 0.35
63 0.32
64 0.29
65 0.23
66 0.16
67 0.14
68 0.12
69 0.08
70 0.06
71 0.06
72 0.05
73 0.05
74 0.04
75 0.05
76 0.06
77 0.08
78 0.08
79 0.08
80 0.08
81 0.1
82 0.12
83 0.1
84 0.1
85 0.09
86 0.1
87 0.1
88 0.1
89 0.09
90 0.09
91 0.12
92 0.15
93 0.15
94 0.15
95 0.16
96 0.19
97 0.23
98 0.31
99 0.31
100 0.28
101 0.3
102 0.31
103 0.31
104 0.29
105 0.24
106 0.16
107 0.13
108 0.14
109 0.12
110 0.13
111 0.18
112 0.18
113 0.16
114 0.19
115 0.2
116 0.27
117 0.27
118 0.25
119 0.23
120 0.25
121 0.3
122 0.32
123 0.34
124 0.28
125 0.33
126 0.38
127 0.38
128 0.4
129 0.41
130 0.46
131 0.47
132 0.47
133 0.42
134 0.39
135 0.36
136 0.36
137 0.34
138 0.3
139 0.32
140 0.33
141 0.36
142 0.34
143 0.33
144 0.3
145 0.27
146 0.23
147 0.18
148 0.16
149 0.12
150 0.13
151 0.15
152 0.16
153 0.16
154 0.12
155 0.11
156 0.12
157 0.13
158 0.12
159 0.15
160 0.15
161 0.14
162 0.16
163 0.17
164 0.17
165 0.16
166 0.16
167 0.13
168 0.12
169 0.12
170 0.11
171 0.1
172 0.09
173 0.08
174 0.08
175 0.08
176 0.09
177 0.08
178 0.07
179 0.08
180 0.11
181 0.12
182 0.14
183 0.13
184 0.12
185 0.13
186 0.13
187 0.13
188 0.12
189 0.11
190 0.09
191 0.09
192 0.09
193 0.08
194 0.08
195 0.08
196 0.09
197 0.09
198 0.1
199 0.1
200 0.11
201 0.11
202 0.1
203 0.1
204 0.1
205 0.12
206 0.12
207 0.12
208 0.12
209 0.12
210 0.12
211 0.12
212 0.11
213 0.07
214 0.06
215 0.06
216 0.09
217 0.1
218 0.1
219 0.1
220 0.1
221 0.11
222 0.11
223 0.11
224 0.08
225 0.07
226 0.07
227 0.07
228 0.08
229 0.08
230 0.08
231 0.08
232 0.08
233 0.08
234 0.07
235 0.07
236 0.06
237 0.05
238 0.04
239 0.04
240 0.04
241 0.04
242 0.04
243 0.04
244 0.04
245 0.04
246 0.05
247 0.04
248 0.04
249 0.05
250 0.05
251 0.06
252 0.07
253 0.07
254 0.08
255 0.08
256 0.08
257 0.08
258 0.08
259 0.08
260 0.07
261 0.1
262 0.11
263 0.12
264 0.12
265 0.12
266 0.11
267 0.11
268 0.11
269 0.08
270 0.06
271 0.05
272 0.04
273 0.04
274 0.05
275 0.05
276 0.06
277 0.07
278 0.07
279 0.08
280 0.09
281 0.11
282 0.15
283 0.16
284 0.15
285 0.15
286 0.15
287 0.15
288 0.17
289 0.18
290 0.15
291 0.15
292 0.17
293 0.2
294 0.24
295 0.25
296 0.25
297 0.25
298 0.25
299 0.24
300 0.22
301 0.25
302 0.22
303 0.21
304 0.21
305 0.23
306 0.25
307 0.24
308 0.23
309 0.19
310 0.18
311 0.19
312 0.2
313 0.15
314 0.13
315 0.15
316 0.16
317 0.16
318 0.16
319 0.14
320 0.13
321 0.12
322 0.13
323 0.15
324 0.15
325 0.17
326 0.21
327 0.22
328 0.21
329 0.21
330 0.2
331 0.17
332 0.18
333 0.16
334 0.13
335 0.13
336 0.14
337 0.13
338 0.14
339 0.15
340 0.15
341 0.15
342 0.15
343 0.15
344 0.14
345 0.15
346 0.14
347 0.13
348 0.12
349 0.11
350 0.11
351 0.11
352 0.13
353 0.14
354 0.14
355 0.15
356 0.14
357 0.14
358 0.14
359 0.15
360 0.13
361 0.12
362 0.12
363 0.12
364 0.12
365 0.12
366 0.13
367 0.13
368 0.17
369 0.21
370 0.2
371 0.19
372 0.21
373 0.25
374 0.23
375 0.23
376 0.21
377 0.18
378 0.19
379 0.2
380 0.17
381 0.16
382 0.18
383 0.17
384 0.16
385 0.17
386 0.17
387 0.17
388 0.16
389 0.15
390 0.15
391 0.18
392 0.17
393 0.16
394 0.15
395 0.14
396 0.14
397 0.13
398 0.14
399 0.12
400 0.12
401 0.16
402 0.21
403 0.25
404 0.3
405 0.31
406 0.3
407 0.34
408 0.37
409 0.36
410 0.32
411 0.3
412 0.27
413 0.31
414 0.32
415 0.32
416 0.3
417 0.27
418 0.29
419 0.28
420 0.28
421 0.23
422 0.22
423 0.19
424 0.19
425 0.2
426 0.23