Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8LJ87

Protein Details
Accession J8LJ87    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
127-149DDENKNTRERWKRRGERIKEIYEBasic
NLS Segment(s)
PositionSequence
136-140RWKRR
Subcellular Location(s) nucl 16, mito_nucl 12.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010487  NGRN/Rrg9  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF06413  Neugrin  
Amino Acid Sequences MNLLRVASRSFHCMPFGSLLNENKRSSSKGIIKLINKSSLSNKEFTGKVRDNTKELPEWKKQKMAVRKKLQGQRWNPSKRISQEQMEALRLLKFNFPEQTASDLADRFKISPEAVRRILKSNWKRTDDENKNTRERWKRRGERIKEIYETSEQEVDFISNRIVNGRKLIIGSSTDASELIAKSVRTYGNSKYNDKVPEKKSTNKLHLLKHLSSKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.3
4 0.27
5 0.3
6 0.34
7 0.4
8 0.45
9 0.43
10 0.42
11 0.42
12 0.42
13 0.39
14 0.42
15 0.42
16 0.45
17 0.51
18 0.55
19 0.57
20 0.61
21 0.62
22 0.59
23 0.51
24 0.46
25 0.46
26 0.48
27 0.47
28 0.41
29 0.37
30 0.35
31 0.36
32 0.36
33 0.38
34 0.34
35 0.36
36 0.42
37 0.44
38 0.43
39 0.46
40 0.47
41 0.45
42 0.45
43 0.47
44 0.49
45 0.54
46 0.53
47 0.54
48 0.55
49 0.56
50 0.62
51 0.66
52 0.67
53 0.69
54 0.72
55 0.76
56 0.79
57 0.79
58 0.78
59 0.74
60 0.74
61 0.74
62 0.74
63 0.67
64 0.64
65 0.62
66 0.57
67 0.58
68 0.52
69 0.45
70 0.42
71 0.44
72 0.41
73 0.36
74 0.32
75 0.24
76 0.21
77 0.18
78 0.16
79 0.13
80 0.12
81 0.13
82 0.15
83 0.15
84 0.15
85 0.15
86 0.17
87 0.16
88 0.16
89 0.15
90 0.14
91 0.13
92 0.13
93 0.12
94 0.09
95 0.1
96 0.1
97 0.09
98 0.13
99 0.17
100 0.21
101 0.24
102 0.26
103 0.27
104 0.3
105 0.33
106 0.39
107 0.43
108 0.48
109 0.52
110 0.54
111 0.55
112 0.56
113 0.64
114 0.63
115 0.63
116 0.6
117 0.58
118 0.58
119 0.59
120 0.62
121 0.61
122 0.6
123 0.6
124 0.64
125 0.68
126 0.75
127 0.83
128 0.82
129 0.82
130 0.82
131 0.78
132 0.7
133 0.62
134 0.54
135 0.46
136 0.41
137 0.33
138 0.27
139 0.21
140 0.19
141 0.18
142 0.15
143 0.13
144 0.11
145 0.1
146 0.08
147 0.09
148 0.13
149 0.15
150 0.15
151 0.17
152 0.18
153 0.18
154 0.18
155 0.18
156 0.16
157 0.15
158 0.17
159 0.15
160 0.14
161 0.13
162 0.12
163 0.12
164 0.13
165 0.11
166 0.1
167 0.11
168 0.11
169 0.12
170 0.16
171 0.17
172 0.19
173 0.22
174 0.27
175 0.34
176 0.4
177 0.43
178 0.43
179 0.48
180 0.53
181 0.57
182 0.59
183 0.55
184 0.6
185 0.63
186 0.68
187 0.71
188 0.73
189 0.74
190 0.75
191 0.77
192 0.73
193 0.77
194 0.75
195 0.7