Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4VLL6

Protein Details
Accession A0A4Q4VLL6    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-67ASPVPRTRSKRSKSSKKKHKAKATSPVDLHydrophilic
NLS Segment(s)
PositionSequence
42-60VPRTRSKRSKSSKKKHKAK
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MSDQPSYSTTNSGSQFQPLLHPPAPLSQGDDSSTVAHRASPVPRTRSKRSKSSKKKHKAKATSPVDLIGIGSQFDNATGSKSNADKSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.23
4 0.25
5 0.22
6 0.27
7 0.24
8 0.24
9 0.22
10 0.25
11 0.26
12 0.22
13 0.23
14 0.17
15 0.17
16 0.18
17 0.18
18 0.15
19 0.14
20 0.15
21 0.12
22 0.11
23 0.1
24 0.1
25 0.12
26 0.13
27 0.18
28 0.23
29 0.27
30 0.35
31 0.42
32 0.49
33 0.56
34 0.59
35 0.63
36 0.68
37 0.74
38 0.78
39 0.83
40 0.85
41 0.87
42 0.92
43 0.92
44 0.92
45 0.91
46 0.88
47 0.88
48 0.83
49 0.77
50 0.68
51 0.59
52 0.48
53 0.38
54 0.3
55 0.2
56 0.13
57 0.08
58 0.07
59 0.07
60 0.06
61 0.06
62 0.07
63 0.07
64 0.09
65 0.11
66 0.12
67 0.16
68 0.19