Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4VZS7

Protein Details
Accession A0A4Q4VZS7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
26-55RDVFISRLDRRRRDSRQRRPLRRRHAAALSBasic
NLS Segment(s)
PositionSequence
35-51RRRRDSRQRRPLRRRHA
Subcellular Location(s) nucl 13, cyto 7, mito 4, extr 2
Family & Domain DBs
Amino Acid Sequences MTCTLLLSGLALASHASPAAAAAAERDVFISRLDRRRRDSRQRRPLRRRHAAALSPPTKLVQAQLDEEYGFEAHDSWNMCASTITLGRQEDHDRLHGGEDGSCGGLLSEDSVRRTEEAPVWEDEIGNKDEALDVDLLRGSELRNMASDPAQADSDQMEETTRRSANATDMILIRWKYDGERTHGQETPRLRLQLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.07
11 0.08
12 0.08
13 0.09
14 0.09
15 0.1
16 0.11
17 0.15
18 0.21
19 0.3
20 0.39
21 0.45
22 0.51
23 0.61
24 0.7
25 0.76
26 0.81
27 0.83
28 0.85
29 0.9
30 0.94
31 0.94
32 0.95
33 0.94
34 0.93
35 0.87
36 0.83
37 0.8
38 0.74
39 0.7
40 0.7
41 0.61
42 0.51
43 0.46
44 0.39
45 0.32
46 0.27
47 0.22
48 0.15
49 0.15
50 0.16
51 0.17
52 0.17
53 0.16
54 0.16
55 0.14
56 0.1
57 0.08
58 0.06
59 0.05
60 0.05
61 0.07
62 0.08
63 0.08
64 0.11
65 0.11
66 0.11
67 0.11
68 0.11
69 0.11
70 0.1
71 0.11
72 0.1
73 0.11
74 0.11
75 0.14
76 0.16
77 0.16
78 0.16
79 0.16
80 0.15
81 0.15
82 0.15
83 0.14
84 0.12
85 0.1
86 0.09
87 0.08
88 0.07
89 0.07
90 0.06
91 0.04
92 0.04
93 0.03
94 0.04
95 0.06
96 0.06
97 0.08
98 0.09
99 0.09
100 0.1
101 0.11
102 0.12
103 0.14
104 0.15
105 0.17
106 0.17
107 0.18
108 0.17
109 0.16
110 0.15
111 0.15
112 0.13
113 0.11
114 0.1
115 0.09
116 0.09
117 0.09
118 0.1
119 0.07
120 0.06
121 0.07
122 0.07
123 0.07
124 0.07
125 0.07
126 0.06
127 0.08
128 0.09
129 0.09
130 0.1
131 0.1
132 0.12
133 0.12
134 0.13
135 0.11
136 0.12
137 0.12
138 0.11
139 0.11
140 0.11
141 0.11
142 0.1
143 0.09
144 0.09
145 0.09
146 0.1
147 0.15
148 0.15
149 0.15
150 0.16
151 0.17
152 0.2
153 0.24
154 0.23
155 0.21
156 0.21
157 0.21
158 0.25
159 0.24
160 0.21
161 0.17
162 0.17
163 0.17
164 0.24
165 0.27
166 0.3
167 0.39
168 0.43
169 0.48
170 0.5
171 0.5
172 0.48
173 0.48
174 0.49
175 0.46