A0A4Q4UD50

UniProt ID: A0A4Q4UD50   Organism: Monosporascus sp. MC13-8B
Gene: DL766_008869   Protein: Uncharacterized protein
Length: 91 AA

Protein Details

• Accession: A0A4Q4UD50
• Localization Confidence: Low
• Confidence Score: 5
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  1-21	MTRKTWRRHRRAGTRACIGRN	Hydrophilic

• Subcellular Location(s): mito 23.5, cyto_mito 12.5
• Family & Domain DBs:
  • InterPro:
    • IPR036396 Cyt_P450_sf
  • Gene Ontology:
    • GO:0020037 F:heme binding
    • GO:0005506 F:iron ion binding
    • GO:0004497 F:monooxygenase activity
    • GO:0016705 F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• Amino Acid Sequences: MTRKTWRRHRRAGTRACIGRNISLQMQEVAVATLLYRYEFALPSPGWEVEYEEWFNPWPLKPPLKV

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.86
2, 0.81
3, 0.72
4, 0.66
5, 0.57
6, 0.49
7, 0.41
8, 0.36
9, 0.27
10, 0.24
11, 0.22
12, 0.18
13, 0.16
14, 0.13
15, 0.11
16, 0.08
17, 0.07
18, 0.05
19, 0.04
20, 0.04
21, 0.04
22, 0.04
23, 0.04
24, 0.04
25, 0.06
26, 0.06
27, 0.06
28, 0.1
29, 0.1
30, 0.12
31, 0.14
32, 0.14
33, 0.13
34, 0.13
35, 0.17
36, 0.14
37, 0.18
38, 0.19
39, 0.16
40, 0.17
41, 0.18
42, 0.2
43, 0.19
44, 0.18
45, 0.22
46, 0.28