Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4V5M3

Protein Details
Accession A0A4Q4V5M3    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
75-94ARLKKEYDEKQRKKKEKEAEBasic
NLS Segment(s)
PositionSequence
75-118ARLKKEYDEKQRKKKEKEAEKDKGKDGEKEKDKKDESKPDKTGK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MSFPNVWHHRKVAETAAKACEICYRPSSSVLITPDNKDWFYVCPMHLKDTKFCTPIIDHEAIAARKRREEDEEIARLKKEYDEKQRKKKEKEAEKDKGKDGEKEKDKKDESKPDKTGKEQGAGTPPKDEEPKVTFYQQRLNKKRQAEMAKKMRERMKEPDFFPAVPKGDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.43
4 0.42
5 0.39
6 0.36
7 0.34
8 0.28
9 0.28
10 0.27
11 0.29
12 0.29
13 0.31
14 0.33
15 0.27
16 0.29
17 0.29
18 0.31
19 0.29
20 0.31
21 0.33
22 0.34
23 0.32
24 0.28
25 0.26
26 0.21
27 0.23
28 0.23
29 0.19
30 0.24
31 0.25
32 0.3
33 0.33
34 0.34
35 0.34
36 0.38
37 0.42
38 0.36
39 0.34
40 0.32
41 0.29
42 0.3
43 0.32
44 0.26
45 0.21
46 0.21
47 0.25
48 0.23
49 0.25
50 0.27
51 0.21
52 0.23
53 0.25
54 0.26
55 0.27
56 0.31
57 0.32
58 0.33
59 0.38
60 0.38
61 0.37
62 0.35
63 0.3
64 0.25
65 0.23
66 0.23
67 0.25
68 0.34
69 0.44
70 0.53
71 0.63
72 0.73
73 0.79
74 0.79
75 0.8
76 0.79
77 0.78
78 0.8
79 0.8
80 0.79
81 0.79
82 0.76
83 0.71
84 0.67
85 0.58
86 0.54
87 0.49
88 0.49
89 0.49
90 0.53
91 0.53
92 0.55
93 0.56
94 0.57
95 0.6
96 0.62
97 0.6
98 0.63
99 0.67
100 0.66
101 0.67
102 0.64
103 0.64
104 0.55
105 0.52
106 0.43
107 0.39
108 0.41
109 0.4
110 0.36
111 0.31
112 0.29
113 0.28
114 0.3
115 0.28
116 0.25
117 0.25
118 0.3
119 0.3
120 0.35
121 0.36
122 0.36
123 0.44
124 0.47
125 0.54
126 0.57
127 0.62
128 0.64
129 0.65
130 0.68
131 0.69
132 0.71
133 0.69
134 0.72
135 0.74
136 0.77
137 0.75
138 0.77
139 0.74
140 0.71
141 0.67
142 0.66
143 0.66
144 0.63
145 0.61
146 0.62
147 0.6
148 0.53
149 0.51
150 0.48