Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4T9G7

Protein Details
Accession A0A4Q4T9G7   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
124-165ASSRDSKRQHHAPQHQNLHHHHPHQNKKGKQKHDGHQHQQENBasic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016193  Cytidine_deaminase-like  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006139  P:nucleobase-containing compound metabolic process  
Amino Acid Sequences MKTDNYLNLCLEQAELSPLSHRHGCIVVKGGKVIGKGFNDYRPGFDGGALKTGVLPSKSFALDKQELKSKTKRGFRHFEAVFTGARPGRPVLSMHSEMMAINSALSSSSTLAATSLSRFKPSLASSRDSKRQHHAPQHQNLHHHHPHQNKKGKQKHDGHQHQQENPRHKYMNASYNPAKSKTSRSKVSKSSQGNGRSTYQPNGSSQTETAGDAIQHRRENRHGGITSTVKVLSKGARSHRVDRSAEPSLVQHCLDDRMKNPRLTGADIYIARLGAPVRKSETHKGKSDEIAFQQETSPEVDTCVSPTLSVTSTTSSGSLHDELRCKDHKSTGPKTSNTVHPVFDRRQVRDSRPCYRCVSYMHSAGIRRCFWTNHEGQWESAKVRDLFDQLAGASSCDGKGGDSDRLGSVFVTKHEILMLRRLAGVHDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.16
5 0.17
6 0.22
7 0.25
8 0.24
9 0.24
10 0.28
11 0.29
12 0.28
13 0.35
14 0.36
15 0.33
16 0.34
17 0.34
18 0.31
19 0.31
20 0.3
21 0.28
22 0.25
23 0.29
24 0.32
25 0.34
26 0.39
27 0.38
28 0.38
29 0.36
30 0.36
31 0.31
32 0.31
33 0.31
34 0.24
35 0.27
36 0.24
37 0.2
38 0.18
39 0.2
40 0.2
41 0.17
42 0.16
43 0.14
44 0.18
45 0.2
46 0.2
47 0.2
48 0.25
49 0.31
50 0.34
51 0.37
52 0.42
53 0.44
54 0.5
55 0.56
56 0.56
57 0.58
58 0.63
59 0.67
60 0.68
61 0.73
62 0.73
63 0.75
64 0.67
65 0.61
66 0.56
67 0.49
68 0.4
69 0.32
70 0.31
71 0.23
72 0.22
73 0.21
74 0.19
75 0.18
76 0.19
77 0.19
78 0.19
79 0.24
80 0.26
81 0.25
82 0.24
83 0.23
84 0.22
85 0.21
86 0.17
87 0.1
88 0.07
89 0.06
90 0.06
91 0.05
92 0.06
93 0.06
94 0.06
95 0.07
96 0.07
97 0.07
98 0.07
99 0.08
100 0.08
101 0.1
102 0.15
103 0.15
104 0.17
105 0.18
106 0.18
107 0.22
108 0.24
109 0.31
110 0.29
111 0.32
112 0.36
113 0.42
114 0.51
115 0.5
116 0.52
117 0.51
118 0.56
119 0.61
120 0.66
121 0.69
122 0.7
123 0.75
124 0.81
125 0.77
126 0.74
127 0.69
128 0.68
129 0.63
130 0.59
131 0.56
132 0.56
133 0.63
134 0.66
135 0.72
136 0.69
137 0.75
138 0.78
139 0.78
140 0.79
141 0.78
142 0.77
143 0.78
144 0.82
145 0.79
146 0.8
147 0.78
148 0.74
149 0.74
150 0.72
151 0.7
152 0.64
153 0.6
154 0.51
155 0.46
156 0.46
157 0.42
158 0.45
159 0.39
160 0.41
161 0.4
162 0.45
163 0.47
164 0.42
165 0.38
166 0.31
167 0.38
168 0.41
169 0.45
170 0.49
171 0.53
172 0.58
173 0.64
174 0.67
175 0.67
176 0.61
177 0.6
178 0.58
179 0.58
180 0.53
181 0.47
182 0.45
183 0.41
184 0.39
185 0.35
186 0.3
187 0.25
188 0.25
189 0.26
190 0.24
191 0.21
192 0.19
193 0.17
194 0.15
195 0.14
196 0.13
197 0.09
198 0.08
199 0.1
200 0.13
201 0.15
202 0.17
203 0.18
204 0.21
205 0.23
206 0.28
207 0.27
208 0.3
209 0.27
210 0.26
211 0.29
212 0.28
213 0.26
214 0.21
215 0.2
216 0.14
217 0.14
218 0.14
219 0.13
220 0.15
221 0.19
222 0.23
223 0.32
224 0.36
225 0.42
226 0.46
227 0.5
228 0.48
229 0.45
230 0.47
231 0.41
232 0.37
233 0.31
234 0.27
235 0.22
236 0.22
237 0.2
238 0.14
239 0.11
240 0.15
241 0.17
242 0.17
243 0.19
244 0.26
245 0.31
246 0.32
247 0.32
248 0.32
249 0.32
250 0.33
251 0.31
252 0.23
253 0.23
254 0.21
255 0.22
256 0.18
257 0.16
258 0.12
259 0.12
260 0.11
261 0.1
262 0.11
263 0.12
264 0.16
265 0.2
266 0.25
267 0.34
268 0.44
269 0.46
270 0.51
271 0.53
272 0.52
273 0.53
274 0.52
275 0.46
276 0.39
277 0.39
278 0.33
279 0.3
280 0.27
281 0.23
282 0.2
283 0.18
284 0.17
285 0.1
286 0.11
287 0.11
288 0.1
289 0.12
290 0.13
291 0.11
292 0.09
293 0.1
294 0.11
295 0.11
296 0.12
297 0.11
298 0.11
299 0.12
300 0.12
301 0.13
302 0.11
303 0.11
304 0.13
305 0.14
306 0.15
307 0.18
308 0.22
309 0.23
310 0.29
311 0.32
312 0.32
313 0.33
314 0.38
315 0.42
316 0.47
317 0.54
318 0.58
319 0.62
320 0.6
321 0.62
322 0.59
323 0.59
324 0.56
325 0.5
326 0.42
327 0.39
328 0.44
329 0.42
330 0.46
331 0.45
332 0.43
333 0.49
334 0.53
335 0.57
336 0.61
337 0.65
338 0.67
339 0.64
340 0.65
341 0.63
342 0.59
343 0.55
344 0.5
345 0.5
346 0.45
347 0.45
348 0.44
349 0.42
350 0.43
351 0.43
352 0.45
353 0.39
354 0.36
355 0.35
356 0.34
357 0.34
358 0.38
359 0.39
360 0.38
361 0.44
362 0.43
363 0.41
364 0.45
365 0.44
366 0.37
367 0.35
368 0.35
369 0.28
370 0.28
371 0.31
372 0.28
373 0.26
374 0.25
375 0.24
376 0.17
377 0.19
378 0.18
379 0.15
380 0.13
381 0.12
382 0.11
383 0.11
384 0.11
385 0.08
386 0.12
387 0.15
388 0.18
389 0.19
390 0.21
391 0.21
392 0.21
393 0.21
394 0.18
395 0.18
396 0.16
397 0.16
398 0.21
399 0.2
400 0.2
401 0.22
402 0.26
403 0.25
404 0.31
405 0.32
406 0.26
407 0.27
408 0.27