Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2L7S2

Protein Details
Accession E2L7S2    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
12-31FKNPNYTKNREKRMQEKAENHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15.5, cyto_nucl 13, nucl 7.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
KEGG mpr:MPER_01942  -  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences EQLSYLHELRPFKNPNYTKNREKRMQEKAENGGMDVDGGADEEIPTYTSIEAPPSVLPQKHWCDITGLEAPYTDPTTGLRYHDKNIYALIKGMSASIAKDYLSGTSISFVSPCVLTYYITARGVHSIVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.55
3 0.62
4 0.67
5 0.68
6 0.73
7 0.78
8 0.76
9 0.8
10 0.79
11 0.79
12 0.81
13 0.77
14 0.73
15 0.69
16 0.65
17 0.57
18 0.48
19 0.38
20 0.28
21 0.21
22 0.15
23 0.09
24 0.04
25 0.04
26 0.04
27 0.03
28 0.03
29 0.04
30 0.04
31 0.05
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.07
38 0.07
39 0.08
40 0.08
41 0.1
42 0.13
43 0.12
44 0.14
45 0.2
46 0.23
47 0.25
48 0.25
49 0.23
50 0.21
51 0.21
52 0.23
53 0.2
54 0.16
55 0.14
56 0.14
57 0.13
58 0.13
59 0.14
60 0.1
61 0.06
62 0.07
63 0.1
64 0.11
65 0.13
66 0.18
67 0.19
68 0.22
69 0.26
70 0.26
71 0.24
72 0.26
73 0.25
74 0.2
75 0.2
76 0.17
77 0.13
78 0.12
79 0.12
80 0.09
81 0.08
82 0.08
83 0.08
84 0.08
85 0.07
86 0.08
87 0.08
88 0.08
89 0.09
90 0.09
91 0.08
92 0.09
93 0.09
94 0.09
95 0.09
96 0.09
97 0.09
98 0.09
99 0.09
100 0.11
101 0.11
102 0.12
103 0.14
104 0.17
105 0.2
106 0.23
107 0.23
108 0.21
109 0.23