Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4UIR4

Protein Details
Accession A0A4Q4UIR4    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
45-74KIGHKAYKCKTPKKPRQDKWKPVPEGQPKEBasic
NLS Segment(s)
PositionSequence
57-59KKP
Subcellular Location(s) nucl 14, mito 9, cyto 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MAVKIDNRHAPRHNNTSYGTAPGPIDLGTVQRKDWNQIQYFNCGKIGHKAYKCKTPKKPRQDKWKPVPEGQPKENQKNDGQAINMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.54
3 0.52
4 0.46
5 0.41
6 0.33
7 0.25
8 0.23
9 0.19
10 0.17
11 0.12
12 0.11
13 0.07
14 0.11
15 0.13
16 0.13
17 0.14
18 0.17
19 0.18
20 0.21
21 0.26
22 0.3
23 0.28
24 0.34
25 0.35
26 0.38
27 0.39
28 0.36
29 0.32
30 0.26
31 0.24
32 0.24
33 0.27
34 0.28
35 0.31
36 0.38
37 0.4
38 0.49
39 0.56
40 0.6
41 0.65
42 0.69
43 0.76
44 0.79
45 0.87
46 0.87
47 0.9
48 0.92
49 0.92
50 0.91
51 0.92
52 0.86
53 0.81
54 0.82
55 0.81
56 0.78
57 0.72
58 0.71
59 0.69
60 0.73
61 0.72
62 0.66
63 0.59
64 0.59
65 0.58
66 0.51