Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4V5D5

Protein Details
Accession A0A4Q4V5D5    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
99-131VCKAGMTKLKPRDRSKRKGKAKKKKTAGAAAGGBasic
NLS Segment(s)
PositionSequence
71-75KDRRK
106-126KLKPRDRSKRKGKAKKKKTAG
Subcellular Location(s) nucl 14.5, cyto_nucl 12, cyto 8.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MDRLSNDEFFAKLVELFDYRKVKDHGSISLTQKRLSYDQPLPEATSDTIFPDLHPPRPMPVLIRATNSKAKDRRKEKIKVSTVVEAEALPAFFERYADVCKAGMTKLKPRDRSKRKGKAKKKKTAGAAAGGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.21
5 0.25
6 0.25
7 0.31
8 0.32
9 0.32
10 0.36
11 0.37
12 0.35
13 0.35
14 0.4
15 0.41
16 0.46
17 0.45
18 0.41
19 0.39
20 0.37
21 0.35
22 0.32
23 0.32
24 0.3
25 0.33
26 0.34
27 0.34
28 0.32
29 0.29
30 0.28
31 0.22
32 0.17
33 0.13
34 0.11
35 0.12
36 0.11
37 0.11
38 0.17
39 0.19
40 0.21
41 0.23
42 0.22
43 0.22
44 0.23
45 0.24
46 0.17
47 0.21
48 0.24
49 0.23
50 0.25
51 0.25
52 0.27
53 0.32
54 0.32
55 0.33
56 0.34
57 0.41
58 0.48
59 0.54
60 0.59
61 0.63
62 0.7
63 0.7
64 0.74
65 0.72
66 0.67
67 0.63
68 0.6
69 0.51
70 0.43
71 0.36
72 0.25
73 0.2
74 0.15
75 0.11
76 0.06
77 0.06
78 0.06
79 0.05
80 0.06
81 0.06
82 0.07
83 0.1
84 0.11
85 0.12
86 0.11
87 0.12
88 0.13
89 0.14
90 0.18
91 0.19
92 0.27
93 0.36
94 0.45
95 0.54
96 0.62
97 0.72
98 0.77
99 0.83
100 0.86
101 0.87
102 0.9
103 0.92
104 0.94
105 0.94
106 0.95
107 0.95
108 0.94
109 0.91
110 0.89
111 0.87
112 0.81