Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V1XGV3

Protein Details
Accession A0A4V1XGV3    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
124-149APSARKAPRRPYGRLRGRLRRATDLRBasic
NLS Segment(s)
PositionSequence
120-144RLRPAPSARKAPRRPYGRLRGRLRR
Subcellular Location(s) cyto_nucl 9.5, cyto 9, nucl 8, mito 5, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046797  PDDEXK_12  
Pfam View protein in Pfam  
PF20516  PDDEXK_12  
Amino Acid Sequences MLNDSRFAADNRVVVLSQKKRDDTRQLFPSLGADEGRTLGLLALHDELNTIRDIIATTIRFINTSRSETTWNDYIHGPILRLAVSSTPYVGAENITQAAIAKAFIPAARGTRDPGRQDDRLRPAPSARKAPRRPYGRLRGRLRRATDLRTVDARGAVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.29
3 0.32
4 0.37
5 0.42
6 0.46
7 0.49
8 0.57
9 0.65
10 0.62
11 0.63
12 0.62
13 0.59
14 0.54
15 0.5
16 0.44
17 0.34
18 0.29
19 0.2
20 0.14
21 0.11
22 0.11
23 0.11
24 0.09
25 0.07
26 0.06
27 0.07
28 0.06
29 0.07
30 0.07
31 0.07
32 0.07
33 0.08
34 0.08
35 0.08
36 0.08
37 0.07
38 0.06
39 0.06
40 0.06
41 0.07
42 0.11
43 0.1
44 0.11
45 0.12
46 0.12
47 0.13
48 0.13
49 0.18
50 0.17
51 0.2
52 0.2
53 0.2
54 0.23
55 0.24
56 0.27
57 0.26
58 0.24
59 0.22
60 0.21
61 0.2
62 0.19
63 0.18
64 0.14
65 0.1
66 0.1
67 0.09
68 0.08
69 0.08
70 0.07
71 0.08
72 0.08
73 0.07
74 0.06
75 0.07
76 0.07
77 0.07
78 0.07
79 0.05
80 0.06
81 0.06
82 0.06
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.04
89 0.04
90 0.05
91 0.05
92 0.07
93 0.07
94 0.1
95 0.12
96 0.13
97 0.16
98 0.22
99 0.27
100 0.29
101 0.34
102 0.38
103 0.42
104 0.46
105 0.51
106 0.53
107 0.56
108 0.55
109 0.5
110 0.51
111 0.54
112 0.56
113 0.58
114 0.58
115 0.61
116 0.68
117 0.75
118 0.78
119 0.76
120 0.78
121 0.77
122 0.8
123 0.79
124 0.81
125 0.82
126 0.83
127 0.86
128 0.86
129 0.82
130 0.81
131 0.76
132 0.71
133 0.7
134 0.64
135 0.59
136 0.54
137 0.5
138 0.41