Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4VIF5

Protein Details
Accession A0A4Q4VIF5   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
121-147RTFSNPVKPCPKCKRPIEKRGGCNHMHHydrophilic
NLS Segment(s)
PositionSequence
100-107KRKVEARK
Subcellular Location(s) nucl 14, cyto_nucl 13.5, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR031127  E3_UB_ligase_RBR  
Gene Ontology GO:0004842  F:ubiquitin-protein transferase activity  
GO:0016567  P:protein ubiquitination  
Amino Acid Sequences MIAWHDEYTCDEYDGFLTDPLNFRSQAQLAGEAAEARDRAMDDLQRQIEDSERQFNYEILASRQRTEALRLSELARIEGERQEALERARREEAQRQAEEKRKVEARKKAEEEATQVAFTNRTFSNPVKPCPKCKRPIEKRGGCNHMHCPLCNINFDWGPLFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.12
4 0.11
5 0.12
6 0.15
7 0.17
8 0.19
9 0.17
10 0.17
11 0.21
12 0.22
13 0.23
14 0.21
15 0.2
16 0.18
17 0.18
18 0.17
19 0.13
20 0.12
21 0.11
22 0.1
23 0.07
24 0.08
25 0.08
26 0.09
27 0.11
28 0.14
29 0.14
30 0.2
31 0.22
32 0.21
33 0.21
34 0.2
35 0.21
36 0.22
37 0.22
38 0.23
39 0.22
40 0.24
41 0.24
42 0.23
43 0.21
44 0.2
45 0.19
46 0.14
47 0.21
48 0.2
49 0.2
50 0.21
51 0.22
52 0.2
53 0.22
54 0.24
55 0.2
56 0.2
57 0.2
58 0.21
59 0.21
60 0.21
61 0.18
62 0.13
63 0.11
64 0.11
65 0.11
66 0.1
67 0.08
68 0.08
69 0.08
70 0.09
71 0.11
72 0.16
73 0.15
74 0.17
75 0.19
76 0.21
77 0.23
78 0.29
79 0.36
80 0.37
81 0.38
82 0.38
83 0.43
84 0.49
85 0.51
86 0.45
87 0.42
88 0.42
89 0.47
90 0.52
91 0.55
92 0.54
93 0.58
94 0.6
95 0.59
96 0.57
97 0.52
98 0.48
99 0.43
100 0.37
101 0.28
102 0.25
103 0.21
104 0.19
105 0.17
106 0.16
107 0.12
108 0.13
109 0.17
110 0.18
111 0.28
112 0.31
113 0.38
114 0.45
115 0.49
116 0.57
117 0.64
118 0.71
119 0.71
120 0.76
121 0.81
122 0.82
123 0.89
124 0.9
125 0.88
126 0.88
127 0.88
128 0.85
129 0.77
130 0.72
131 0.67
132 0.64
133 0.57
134 0.49
135 0.45
136 0.46
137 0.44
138 0.43
139 0.38
140 0.36
141 0.34
142 0.35