Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4UWI5

Protein Details
Accession A0A4Q4UWI5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-78HYATMKPEQKKAKERKKKNDKKSGKPPAQRBasic
NLS Segment(s)
PositionSequence
56-78EQKKAKERKKKNDKKSGKPPAQR
Subcellular Location(s) E.R. 8, cyto 7, mito 4, plas 4, cyto_pero 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSGQFDFMSKLGATDEAVAVLNDQPFIFTVLVVALVACILQCVLIWYIHYATMKPEQKKAKERKKKNDKKSGKPPAQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.08
4 0.09
5 0.08
6 0.08
7 0.09
8 0.09
9 0.08
10 0.08
11 0.07
12 0.07
13 0.1
14 0.09
15 0.07
16 0.07
17 0.06
18 0.06
19 0.06
20 0.05
21 0.03
22 0.02
23 0.03
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.04
31 0.05
32 0.05
33 0.06
34 0.07
35 0.09
36 0.1
37 0.09
38 0.11
39 0.2
40 0.26
41 0.28
42 0.35
43 0.41
44 0.49
45 0.59
46 0.68
47 0.7
48 0.75
49 0.83
50 0.87
51 0.91
52 0.93
53 0.94
54 0.94
55 0.94
56 0.94
57 0.94
58 0.94