Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4VGK7

Protein Details
Accession A0A4Q4VGK7    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
51-76IESGAAGRRWRRRQRVERLPQKHEVAHydrophilic
NLS Segment(s)
PositionSequence
33-68KIKRKRAEKERERTARADIESGAAGRRWRRRQRVER
Subcellular Location(s) nucl 12, mito 9, cyto 3, pero 2
Family & Domain DBs
Amino Acid Sequences MRFDRAASSRLADFLDGSTGALPAYLVAIAVSKIKRKRAEKERERTARADIESGAAGRRWRRRQRVERLPQKHEVAEQRREVSQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.1
4 0.1
5 0.08
6 0.08
7 0.07
8 0.06
9 0.06
10 0.04
11 0.04
12 0.03
13 0.03
14 0.03
15 0.03
16 0.04
17 0.08
18 0.09
19 0.14
20 0.18
21 0.25
22 0.33
23 0.38
24 0.48
25 0.55
26 0.65
27 0.69
28 0.75
29 0.79
30 0.78
31 0.76
32 0.67
33 0.6
34 0.53
35 0.43
36 0.35
37 0.25
38 0.19
39 0.16
40 0.15
41 0.12
42 0.1
43 0.12
44 0.17
45 0.26
46 0.35
47 0.45
48 0.55
49 0.65
50 0.74
51 0.83
52 0.88
53 0.9
54 0.91
55 0.9
56 0.86
57 0.82
58 0.75
59 0.66
60 0.62
61 0.61
62 0.58
63 0.57
64 0.56
65 0.52