Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4UIY5

Protein Details
Accession A0A4Q4UIY5    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
14-33RSEDRTDRTRRPRWARLLRLBasic
NLS Segment(s)
PositionSequence
63-63R
Subcellular Location(s) mito 13, cyto 6, nucl 4, extr 3
Family & Domain DBs
Amino Acid Sequences MPSQRNANATAAARSEDRTDRTRRPRWARLLRLALLCVFCGPDVVRGDQHTGGRPAARERGERHLARHGHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.22
4 0.24
5 0.28
6 0.33
7 0.41
8 0.5
9 0.56
10 0.63
11 0.68
12 0.72
13 0.77
14 0.81
15 0.78
16 0.77
17 0.74
18 0.66
19 0.58
20 0.5
21 0.4
22 0.3
23 0.23
24 0.15
25 0.1
26 0.07
27 0.07
28 0.06
29 0.1
30 0.11
31 0.12
32 0.14
33 0.15
34 0.18
35 0.2
36 0.21
37 0.2
38 0.21
39 0.21
40 0.22
41 0.22
42 0.23
43 0.28
44 0.3
45 0.32
46 0.34
47 0.41
48 0.48
49 0.49
50 0.49
51 0.52