Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8Q2R2

Protein Details
Accession J8Q2R2   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKIPWRMSTHQKYRQRERLRNVDQVHydrophilic
64-84ALESKKKYKPRSKTLRLLNKSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFKLTSPVAGGLLWKIPWRMSTHQKYRQRERLRNVDQVIKQLTLGLHVQRSQDKGLAYQEALESKKKYKPRSKTLRLLNKSSVFPKENQMSSKDKYWVFDKKAVGYRKGIHKVPKWTKISIRKTPKFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.15
4 0.14
5 0.13
6 0.14
7 0.17
8 0.22
9 0.27
10 0.36
11 0.45
12 0.53
13 0.62
14 0.71
15 0.77
16 0.81
17 0.85
18 0.85
19 0.84
20 0.82
21 0.83
22 0.8
23 0.78
24 0.71
25 0.69
26 0.59
27 0.55
28 0.49
29 0.38
30 0.32
31 0.26
32 0.22
33 0.16
34 0.17
35 0.13
36 0.13
37 0.14
38 0.16
39 0.17
40 0.19
41 0.18
42 0.18
43 0.17
44 0.17
45 0.17
46 0.16
47 0.13
48 0.12
49 0.12
50 0.12
51 0.13
52 0.14
53 0.14
54 0.16
55 0.22
56 0.27
57 0.36
58 0.43
59 0.51
60 0.59
61 0.68
62 0.74
63 0.77
64 0.81
65 0.83
66 0.79
67 0.74
68 0.7
69 0.63
70 0.57
71 0.51
72 0.47
73 0.38
74 0.35
75 0.36
76 0.35
77 0.35
78 0.34
79 0.35
80 0.35
81 0.36
82 0.39
83 0.38
84 0.33
85 0.33
86 0.37
87 0.41
88 0.41
89 0.44
90 0.42
91 0.44
92 0.51
93 0.53
94 0.51
95 0.48
96 0.49
97 0.52
98 0.57
99 0.56
100 0.57
101 0.59
102 0.66
103 0.71
104 0.74
105 0.69
106 0.68
107 0.73
108 0.74
109 0.77
110 0.76
111 0.78