Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4UL07

Protein Details
Accession A0A4Q4UL07    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
128-152GDAASTKKRQRRTPASKKRAPVFKSHydrophilic
NLS Segment(s)
PositionSequence
81-99TPKAKGGAKKGASSAPGSG
103-106GGRK
134-149KKRQRRTPASKKRAPV
Subcellular Location(s) cyto 16, cyto_nucl 12.833, nucl 7.5, mito_nucl 5.166
Family & Domain DBs
Amino Acid Sequences MADSNNTNESAGGKWTDAEKASMMVQIIEQLTSAGGKVRLGELNMPGRTTKSLTHMLGKIKEEAALHKREGGSGSGSVPATPKAKGGAKKGASSAPGSGTGTGGRKRTKTTAAATGSGDEDEKDGDYGDAASTKKRQRRTPASKKRAPVFKSGAKAEDTVSEDGEDEKTSDDVAGPEAADVVNAAIAAANGAAVLDGVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.18
4 0.18
5 0.18
6 0.16
7 0.16
8 0.16
9 0.17
10 0.15
11 0.12
12 0.11
13 0.13
14 0.12
15 0.11
16 0.1
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.08
24 0.09
25 0.11
26 0.13
27 0.14
28 0.16
29 0.18
30 0.24
31 0.25
32 0.25
33 0.23
34 0.23
35 0.24
36 0.23
37 0.2
38 0.18
39 0.24
40 0.25
41 0.3
42 0.32
43 0.35
44 0.37
45 0.37
46 0.34
47 0.28
48 0.28
49 0.23
50 0.25
51 0.26
52 0.25
53 0.24
54 0.25
55 0.25
56 0.24
57 0.24
58 0.19
59 0.16
60 0.13
61 0.13
62 0.13
63 0.12
64 0.12
65 0.11
66 0.13
67 0.12
68 0.11
69 0.11
70 0.12
71 0.17
72 0.21
73 0.25
74 0.31
75 0.32
76 0.33
77 0.34
78 0.32
79 0.29
80 0.25
81 0.22
82 0.14
83 0.13
84 0.12
85 0.11
86 0.1
87 0.1
88 0.11
89 0.13
90 0.16
91 0.17
92 0.19
93 0.21
94 0.24
95 0.26
96 0.28
97 0.29
98 0.33
99 0.32
100 0.33
101 0.3
102 0.28
103 0.24
104 0.2
105 0.17
106 0.09
107 0.07
108 0.06
109 0.06
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.07
117 0.07
118 0.09
119 0.16
120 0.23
121 0.28
122 0.35
123 0.43
124 0.51
125 0.62
126 0.71
127 0.76
128 0.81
129 0.85
130 0.85
131 0.85
132 0.83
133 0.81
134 0.72
135 0.69
136 0.65
137 0.61
138 0.6
139 0.55
140 0.5
141 0.42
142 0.4
143 0.32
144 0.29
145 0.26
146 0.21
147 0.19
148 0.17
149 0.16
150 0.16
151 0.16
152 0.12
153 0.09
154 0.1
155 0.09
156 0.09
157 0.09
158 0.09
159 0.08
160 0.09
161 0.09
162 0.08
163 0.08
164 0.08
165 0.08
166 0.07
167 0.06
168 0.05
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.03
177 0.03
178 0.03
179 0.03