Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4T6F3

Protein Details
Accession A0A4Q4T6F3    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
29-50SQHSVRGNRRPHRNGPHQRGEEBasic
97-116EEDKKEGSKRERKRKSEVVEBasic
NLS Segment(s)
PositionSequence
100-111KKEGSKRERKRK
Subcellular Location(s) nucl 16, cyto_nucl 11.5, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MVTSPLRFNIAVSLRGDVRDQTDPLHQFSQHSVRGNRRPHRNGPHQRGEEHPVGSGHPGLRLQPHEFAQGGSLCVDDSVWIGTPDAPWARTSVLSEEEDKKEGSKRERKRKSEVVEVGSLRRGKGFPDADQDGGEGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.26
4 0.2
5 0.21
6 0.21
7 0.21
8 0.2
9 0.26
10 0.27
11 0.31
12 0.32
13 0.28
14 0.26
15 0.3
16 0.35
17 0.32
18 0.36
19 0.37
20 0.43
21 0.52
22 0.6
23 0.63
24 0.67
25 0.7
26 0.73
27 0.77
28 0.8
29 0.82
30 0.81
31 0.83
32 0.75
33 0.7
34 0.65
35 0.6
36 0.52
37 0.42
38 0.34
39 0.24
40 0.22
41 0.2
42 0.18
43 0.12
44 0.1
45 0.1
46 0.1
47 0.12
48 0.14
49 0.15
50 0.16
51 0.17
52 0.17
53 0.17
54 0.16
55 0.15
56 0.13
57 0.11
58 0.09
59 0.08
60 0.06
61 0.05
62 0.05
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.05
69 0.05
70 0.06
71 0.08
72 0.09
73 0.09
74 0.09
75 0.1
76 0.11
77 0.11
78 0.12
79 0.12
80 0.14
81 0.15
82 0.18
83 0.22
84 0.23
85 0.24
86 0.23
87 0.22
88 0.24
89 0.29
90 0.36
91 0.41
92 0.5
93 0.6
94 0.7
95 0.75
96 0.79
97 0.83
98 0.79
99 0.8
100 0.76
101 0.7
102 0.66
103 0.61
104 0.54
105 0.5
106 0.45
107 0.34
108 0.3
109 0.26
110 0.21
111 0.28
112 0.29
113 0.27
114 0.34
115 0.37
116 0.35
117 0.35
118 0.34