Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8QAV5

Protein Details
Accession J8QAV5   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
77-105EGEALLKRRKNIRKANRQRIKQNNFLSQLHydrophilic
NLS Segment(s)
PositionSequence
83-95KRRKNIRKANRQR
Subcellular Location(s) mito 19, nucl 7.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLARSLGSRWISTSRILYNKQAVNAAVSSCSAGTSLNLNIWKSGKDAVALEDKEYPSWLWSVLGSKQTDEHAAKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.36
4 0.38
5 0.42
6 0.43
7 0.42
8 0.4
9 0.33
10 0.29
11 0.27
12 0.22
13 0.15
14 0.13
15 0.11
16 0.09
17 0.09
18 0.07
19 0.06
20 0.06
21 0.07
22 0.08
23 0.1
24 0.12
25 0.12
26 0.13
27 0.14
28 0.14
29 0.13
30 0.14
31 0.12
32 0.11
33 0.11
34 0.12
35 0.16
36 0.16
37 0.16
38 0.16
39 0.16
40 0.15
41 0.16
42 0.13
43 0.09
44 0.09
45 0.08
46 0.06
47 0.06
48 0.08
49 0.1
50 0.15
51 0.14
52 0.14
53 0.15
54 0.16
55 0.21
56 0.2
57 0.2
58 0.22
59 0.23
60 0.23
61 0.23
62 0.22
63 0.17
64 0.17
65 0.15
66 0.11
67 0.18
68 0.26
69 0.28
70 0.32
71 0.41
72 0.49
73 0.59
74 0.68
75 0.7
76 0.74
77 0.83
78 0.9
79 0.91
80 0.91
81 0.92
82 0.92
83 0.89
84 0.87
85 0.84