Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4T6D0

Protein Details
Accession A0A4Q4T6D0    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
243-262RNNEAARKYRQKRIDRITELHydrophilic
NLS Segment(s)
PositionSequence
226-227KK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR031106  C/EBP  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14686  bZIP  
Amino Acid Sequences MRLIKFPGMSHTEKPQATAALPDAKQSHFIWHPPFSPSSSLSPLYPYPQASGRGRSTISEWPQQLSPPPCASGPPSPPAHPASSSLHPNRADVASPAIWGACSAPGPADLLSTPNGSIGPLTGGWLLYGAGDVGNDVSGGGIIGGADWPFPGSVGPHGLFPFGDTLNDICHENVNITPPSYNLDPSPLELAPPEPDMPYEPLDRTLFAPLSSLSREPPPPEQPRGKKRSLSPVDPITAIKRQRNNEAARKYRQKRIDRITELESELAEVRQERDDLRIRLARQEAETAALRSMLQLKPGSAGTGAKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.36
4 0.32
5 0.32
6 0.28
7 0.29
8 0.29
9 0.3
10 0.3
11 0.29
12 0.32
13 0.3
14 0.33
15 0.28
16 0.34
17 0.35
18 0.37
19 0.38
20 0.38
21 0.39
22 0.35
23 0.35
24 0.32
25 0.31
26 0.31
27 0.31
28 0.27
29 0.29
30 0.28
31 0.28
32 0.28
33 0.25
34 0.22
35 0.25
36 0.31
37 0.31
38 0.36
39 0.35
40 0.35
41 0.35
42 0.33
43 0.33
44 0.35
45 0.36
46 0.37
47 0.35
48 0.34
49 0.35
50 0.35
51 0.38
52 0.33
53 0.33
54 0.28
55 0.28
56 0.26
57 0.27
58 0.3
59 0.29
60 0.3
61 0.31
62 0.32
63 0.32
64 0.35
65 0.37
66 0.35
67 0.29
68 0.29
69 0.28
70 0.3
71 0.36
72 0.35
73 0.38
74 0.37
75 0.36
76 0.35
77 0.3
78 0.27
79 0.19
80 0.21
81 0.14
82 0.14
83 0.13
84 0.11
85 0.1
86 0.09
87 0.09
88 0.05
89 0.05
90 0.05
91 0.06
92 0.06
93 0.07
94 0.07
95 0.07
96 0.06
97 0.07
98 0.08
99 0.09
100 0.08
101 0.08
102 0.08
103 0.07
104 0.07
105 0.06
106 0.06
107 0.05
108 0.06
109 0.06
110 0.06
111 0.05
112 0.06
113 0.05
114 0.04
115 0.04
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.02
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.04
141 0.07
142 0.07
143 0.08
144 0.09
145 0.09
146 0.09
147 0.09
148 0.09
149 0.07
150 0.07
151 0.06
152 0.06
153 0.07
154 0.08
155 0.08
156 0.06
157 0.07
158 0.07
159 0.07
160 0.07
161 0.1
162 0.1
163 0.1
164 0.1
165 0.1
166 0.13
167 0.13
168 0.13
169 0.1
170 0.12
171 0.12
172 0.13
173 0.16
174 0.13
175 0.12
176 0.11
177 0.12
178 0.11
179 0.12
180 0.12
181 0.09
182 0.09
183 0.11
184 0.13
185 0.15
186 0.15
187 0.14
188 0.17
189 0.17
190 0.18
191 0.17
192 0.18
193 0.16
194 0.14
195 0.14
196 0.11
197 0.13
198 0.14
199 0.14
200 0.12
201 0.16
202 0.18
203 0.2
204 0.26
205 0.33
206 0.37
207 0.44
208 0.53
209 0.59
210 0.67
211 0.71
212 0.71
213 0.68
214 0.68
215 0.71
216 0.68
217 0.63
218 0.6
219 0.57
220 0.53
221 0.48
222 0.44
223 0.37
224 0.37
225 0.38
226 0.38
227 0.4
228 0.42
229 0.49
230 0.56
231 0.6
232 0.63
233 0.67
234 0.69
235 0.71
236 0.78
237 0.76
238 0.77
239 0.78
240 0.78
241 0.78
242 0.8
243 0.81
244 0.76
245 0.75
246 0.7
247 0.64
248 0.56
249 0.47
250 0.37
251 0.28
252 0.22
253 0.17
254 0.14
255 0.12
256 0.12
257 0.14
258 0.15
259 0.14
260 0.2
261 0.28
262 0.29
263 0.35
264 0.39
265 0.38
266 0.44
267 0.48
268 0.44
269 0.38
270 0.4
271 0.33
272 0.32
273 0.33
274 0.27
275 0.23
276 0.2
277 0.18
278 0.16
279 0.22
280 0.18
281 0.21
282 0.21
283 0.21
284 0.23
285 0.24
286 0.23
287 0.19