Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8PRP3

Protein Details
Accession J8PRP3    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MAATKELKQPKEPKKRTTRRKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
8-29KQPKEPKKRTTRRKKDPNAPKR
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAATKELKQPKEPKKRTTRRKKDPNAPKRGLSAYMFFANETRDIVRSENPDVTFGQVGRILGERWKALTAEEKVPYESKAQADKKRYESEKELYNATRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.88
3 0.9
4 0.91
5 0.92
6 0.92
7 0.95
8 0.95
9 0.94
10 0.95
11 0.94
12 0.93
13 0.86
14 0.77
15 0.7
16 0.62
17 0.54
18 0.45
19 0.36
20 0.28
21 0.26
22 0.23
23 0.19
24 0.18
25 0.15
26 0.14
27 0.12
28 0.1
29 0.09
30 0.1
31 0.11
32 0.14
33 0.15
34 0.17
35 0.19
36 0.18
37 0.18
38 0.18
39 0.18
40 0.15
41 0.13
42 0.12
43 0.1
44 0.09
45 0.09
46 0.09
47 0.09
48 0.1
49 0.12
50 0.11
51 0.11
52 0.12
53 0.11
54 0.12
55 0.18
56 0.19
57 0.23
58 0.25
59 0.25
60 0.26
61 0.27
62 0.28
63 0.24
64 0.23
65 0.22
66 0.28
67 0.36
68 0.41
69 0.48
70 0.54
71 0.58
72 0.64
73 0.65
74 0.62
75 0.61
76 0.59
77 0.59
78 0.55
79 0.54