Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4U6W1

Protein Details
Accession A0A4Q4U6W1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPKLQKRNRPTERARDQEADHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, mito 5
Family & Domain DBs
Amino Acid Sequences MPKLQKRNRPTERARDQEADRTRRSGAPSPEPRPPPDVLSAKPGEGGRRDPDPKAVAGSGSQSQPAAGATSGCGDEDGREKPCPRGDTGKPVTLTLYCPKCTRNTHESGTAKQHAKGFGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.75
3 0.69
4 0.68
5 0.69
6 0.65
7 0.57
8 0.52
9 0.48
10 0.45
11 0.48
12 0.46
13 0.43
14 0.46
15 0.53
16 0.54
17 0.6
18 0.6
19 0.57
20 0.53
21 0.48
22 0.4
23 0.39
24 0.38
25 0.31
26 0.34
27 0.33
28 0.29
29 0.3
30 0.28
31 0.23
32 0.21
33 0.23
34 0.19
35 0.24
36 0.26
37 0.24
38 0.27
39 0.26
40 0.24
41 0.22
42 0.2
43 0.14
44 0.12
45 0.14
46 0.11
47 0.1
48 0.1
49 0.08
50 0.08
51 0.08
52 0.08
53 0.06
54 0.05
55 0.04
56 0.04
57 0.05
58 0.06
59 0.05
60 0.06
61 0.05
62 0.06
63 0.09
64 0.11
65 0.13
66 0.17
67 0.18
68 0.22
69 0.28
70 0.29
71 0.3
72 0.36
73 0.37
74 0.44
75 0.47
76 0.49
77 0.44
78 0.42
79 0.4
80 0.33
81 0.33
82 0.31
83 0.31
84 0.28
85 0.29
86 0.31
87 0.37
88 0.42
89 0.47
90 0.46
91 0.48
92 0.5
93 0.58
94 0.6
95 0.58
96 0.6
97 0.6
98 0.54
99 0.52
100 0.51