Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4VWP9

Protein Details
Accession A0A4Q4VWP9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
79-98ERKQTILKKRARRAAREVSEHydrophilic
NLS Segment(s)
PositionSequence
86-91KKRARR
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MVHRVLFWSGFGMTTTTITSHPNLPYLCVAVRLWQLGLEMRPFFNRGSLWAYPVFAGAGASFGYWLQGVEERQTAVLEERKQTILKKRARRAAREVSEAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.1
5 0.12
6 0.13
7 0.17
8 0.17
9 0.21
10 0.2
11 0.21
12 0.21
13 0.21
14 0.19
15 0.17
16 0.16
17 0.15
18 0.16
19 0.15
20 0.14
21 0.12
22 0.12
23 0.11
24 0.12
25 0.11
26 0.11
27 0.11
28 0.12
29 0.13
30 0.12
31 0.12
32 0.11
33 0.11
34 0.16
35 0.15
36 0.16
37 0.15
38 0.16
39 0.14
40 0.14
41 0.12
42 0.06
43 0.06
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.07
55 0.08
56 0.1
57 0.11
58 0.1
59 0.11
60 0.11
61 0.11
62 0.12
63 0.17
64 0.19
65 0.2
66 0.23
67 0.25
68 0.27
69 0.32
70 0.39
71 0.42
72 0.49
73 0.57
74 0.64
75 0.71
76 0.78
77 0.8
78 0.79
79 0.8
80 0.77