Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1XI67

Protein Details
Accession A0A4V1XI67    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
111-132ASPDGRARARRRHPHALRTSGSHydrophilic
NLS Segment(s)
PositionSequence
118-122RARRR
Subcellular Location(s) nucl 8, cyto 6, pero 6, mito_nucl 6, cyto_pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036226  LipOase_C_sf  
Gene Ontology GO:0008152  P:metabolic process  
Amino Acid Sequences MGLTAADASAAADVAIELFPKNSAWDNSHIGGFRFGAPYQTQRTDMRQNFMDSDYVQQTFGYLENAPQYPIFLMTVEYAEAFVDSYYEGPNAVACDAELQTWLDEVNSAAASPDGRARARRRHPHALRTSGSAGGHPYADKGNTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.05
4 0.05
5 0.05
6 0.06
7 0.07
8 0.09
9 0.12
10 0.15
11 0.18
12 0.22
13 0.26
14 0.27
15 0.29
16 0.28
17 0.25
18 0.23
19 0.21
20 0.18
21 0.16
22 0.14
23 0.15
24 0.16
25 0.2
26 0.23
27 0.25
28 0.27
29 0.27
30 0.32
31 0.39
32 0.4
33 0.4
34 0.37
35 0.36
36 0.34
37 0.33
38 0.29
39 0.19
40 0.2
41 0.18
42 0.16
43 0.14
44 0.12
45 0.12
46 0.11
47 0.1
48 0.09
49 0.07
50 0.07
51 0.09
52 0.1
53 0.1
54 0.09
55 0.09
56 0.07
57 0.08
58 0.07
59 0.05
60 0.06
61 0.05
62 0.06
63 0.06
64 0.05
65 0.05
66 0.05
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.04
73 0.04
74 0.04
75 0.05
76 0.04
77 0.05
78 0.05
79 0.05
80 0.05
81 0.04
82 0.06
83 0.06
84 0.06
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.05
91 0.05
92 0.05
93 0.06
94 0.05
95 0.05
96 0.05
97 0.06
98 0.06
99 0.07
100 0.1
101 0.12
102 0.14
103 0.22
104 0.29
105 0.39
106 0.49
107 0.59
108 0.64
109 0.72
110 0.78
111 0.81
112 0.84
113 0.82
114 0.73
115 0.68
116 0.62
117 0.54
118 0.47
119 0.38
120 0.31
121 0.24
122 0.23
123 0.17
124 0.17
125 0.17