Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4VXZ7

Protein Details
Accession A0A4Q4VXZ7   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MAPKRTQPKKTQPKKTQPKKTQPKKARKEHDGYYTNHydrophilic
NLS Segment(s)
PositionSequence
4-28KRTQPKKTQPKKTQPKKTQPKKARK
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003656  Znf_BED  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF02892  zf-BED  
Amino Acid Sequences MAPKRTQPKKTQPKKTQPKKTQPKKARKEHDGYYTNDGKRWYCNICKKTISAKGSGIPTHMNKRHNPKSAFAKKSANGPQVQCSKPGCTYKATNFNNYQHHHRSRHGHRGSSKGLHDEFLRAQTEQENSDEGSSDEEDGGEVDGGGHDHAPGPDHGPNDDGEAGAGAPAGIASDVGGQVAITAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.95
3 0.95
4 0.95
5 0.95
6 0.95
7 0.95
8 0.95
9 0.95
10 0.95
11 0.94
12 0.94
13 0.93
14 0.91
15 0.87
16 0.82
17 0.81
18 0.75
19 0.69
20 0.66
21 0.63
22 0.55
23 0.5
24 0.46
25 0.37
26 0.35
27 0.36
28 0.35
29 0.36
30 0.45
31 0.46
32 0.5
33 0.52
34 0.51
35 0.55
36 0.57
37 0.51
38 0.44
39 0.42
40 0.4
41 0.41
42 0.38
43 0.31
44 0.27
45 0.28
46 0.33
47 0.36
48 0.37
49 0.4
50 0.5
51 0.57
52 0.61
53 0.59
54 0.56
55 0.62
56 0.67
57 0.65
58 0.59
59 0.56
60 0.48
61 0.54
62 0.55
63 0.49
64 0.42
65 0.4
66 0.42
67 0.43
68 0.42
69 0.38
70 0.32
71 0.3
72 0.31
73 0.33
74 0.28
75 0.25
76 0.28
77 0.29
78 0.38
79 0.38
80 0.38
81 0.39
82 0.42
83 0.46
84 0.45
85 0.46
86 0.44
87 0.49
88 0.47
89 0.48
90 0.53
91 0.53
92 0.61
93 0.58
94 0.56
95 0.53
96 0.56
97 0.56
98 0.51
99 0.45
100 0.39
101 0.36
102 0.31
103 0.28
104 0.24
105 0.21
106 0.2
107 0.2
108 0.15
109 0.15
110 0.16
111 0.18
112 0.16
113 0.16
114 0.14
115 0.13
116 0.13
117 0.13
118 0.1
119 0.11
120 0.1
121 0.1
122 0.08
123 0.08
124 0.08
125 0.07
126 0.08
127 0.05
128 0.04
129 0.04
130 0.04
131 0.05
132 0.05
133 0.05
134 0.04
135 0.06
136 0.06
137 0.08
138 0.09
139 0.12
140 0.15
141 0.16
142 0.17
143 0.16
144 0.17
145 0.18
146 0.18
147 0.14
148 0.11
149 0.1
150 0.1
151 0.09
152 0.08
153 0.04
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05