Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1XKQ1

Protein Details
Accession A0A4V1XKQ1   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
378-397ITRYVGRKVKHKNPDLALKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.833, mito_nucl 10.833, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012462  Peptidase_C78_UfSP1/2  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF07910  Peptidase_C78  
Amino Acid Sequences MSQIQSCPFCGFQAEREYAMLLHMETLHSEDRSPFIVDGEDSGIRAAGVNTASNDEENLVCECPVDGCGEFITLAELDDHVGFHAAEEQPSSEDSDANPVGYPTPRSTSDESAPPRCQERRSETVPAHQRHAETVARWKQILHMSSPLPSSSPKNKKRNSSMTGPRSNEEDMRRRLGKAELGRYAHEDRMPDRLVSLLRNGRYVSSEGIIPVIEQLLRQSPTTCYAYLCHPCVQHISKLRREGGFCGYRNIQMLASYIVGTDAPGAAQFRRKIPSIFRIQDYIENAWDMGINAHGSCEVQAFKNPEPRAAETSLLQTIERYFQSSEHDSRAKVRGTSLPPVYFQHRGHSLTIIGIEKRLDGAMELLVFDPVFRDPDSITRYVGRKVKHKNPDLALKLYRRGDKYLKKYPEFEVLRLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.31
4 0.31
5 0.26
6 0.25
7 0.2
8 0.12
9 0.11
10 0.1
11 0.1
12 0.1
13 0.13
14 0.15
15 0.15
16 0.16
17 0.16
18 0.17
19 0.19
20 0.21
21 0.17
22 0.15
23 0.16
24 0.15
25 0.16
26 0.18
27 0.15
28 0.13
29 0.13
30 0.12
31 0.11
32 0.11
33 0.09
34 0.08
35 0.09
36 0.1
37 0.11
38 0.13
39 0.14
40 0.14
41 0.14
42 0.13
43 0.12
44 0.12
45 0.13
46 0.12
47 0.11
48 0.11
49 0.1
50 0.1
51 0.1
52 0.11
53 0.09
54 0.09
55 0.09
56 0.1
57 0.1
58 0.09
59 0.1
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.08
66 0.08
67 0.06
68 0.07
69 0.07
70 0.06
71 0.11
72 0.11
73 0.11
74 0.12
75 0.12
76 0.12
77 0.13
78 0.15
79 0.11
80 0.11
81 0.11
82 0.16
83 0.16
84 0.16
85 0.15
86 0.13
87 0.15
88 0.16
89 0.18
90 0.14
91 0.18
92 0.2
93 0.25
94 0.29
95 0.31
96 0.33
97 0.38
98 0.41
99 0.43
100 0.44
101 0.41
102 0.44
103 0.43
104 0.43
105 0.43
106 0.46
107 0.46
108 0.49
109 0.54
110 0.49
111 0.55
112 0.6
113 0.54
114 0.51
115 0.46
116 0.42
117 0.36
118 0.39
119 0.31
120 0.24
121 0.31
122 0.34
123 0.33
124 0.33
125 0.32
126 0.32
127 0.35
128 0.35
129 0.27
130 0.25
131 0.24
132 0.25
133 0.26
134 0.21
135 0.17
136 0.17
137 0.21
138 0.27
139 0.37
140 0.45
141 0.55
142 0.6
143 0.68
144 0.76
145 0.79
146 0.74
147 0.73
148 0.73
149 0.73
150 0.75
151 0.68
152 0.59
153 0.52
154 0.49
155 0.44
156 0.4
157 0.39
158 0.34
159 0.38
160 0.38
161 0.35
162 0.36
163 0.33
164 0.33
165 0.3
166 0.32
167 0.31
168 0.31
169 0.31
170 0.34
171 0.34
172 0.3
173 0.26
174 0.22
175 0.18
176 0.22
177 0.22
178 0.18
179 0.15
180 0.15
181 0.15
182 0.15
183 0.19
184 0.17
185 0.17
186 0.18
187 0.19
188 0.17
189 0.18
190 0.18
191 0.14
192 0.1
193 0.1
194 0.09
195 0.09
196 0.08
197 0.06
198 0.05
199 0.05
200 0.04
201 0.04
202 0.05
203 0.07
204 0.09
205 0.09
206 0.1
207 0.11
208 0.15
209 0.17
210 0.16
211 0.14
212 0.14
213 0.2
214 0.22
215 0.23
216 0.22
217 0.21
218 0.21
219 0.26
220 0.26
221 0.27
222 0.32
223 0.36
224 0.38
225 0.43
226 0.46
227 0.43
228 0.42
229 0.4
230 0.39
231 0.39
232 0.34
233 0.33
234 0.31
235 0.3
236 0.3
237 0.28
238 0.2
239 0.14
240 0.14
241 0.11
242 0.1
243 0.09
244 0.07
245 0.07
246 0.06
247 0.06
248 0.05
249 0.04
250 0.03
251 0.04
252 0.05
253 0.06
254 0.12
255 0.13
256 0.17
257 0.2
258 0.21
259 0.24
260 0.28
261 0.35
262 0.4
263 0.42
264 0.4
265 0.4
266 0.39
267 0.4
268 0.39
269 0.32
270 0.23
271 0.19
272 0.17
273 0.15
274 0.14
275 0.1
276 0.07
277 0.06
278 0.06
279 0.06
280 0.06
281 0.06
282 0.06
283 0.06
284 0.08
285 0.08
286 0.08
287 0.13
288 0.18
289 0.21
290 0.29
291 0.29
292 0.32
293 0.35
294 0.38
295 0.39
296 0.36
297 0.34
298 0.27
299 0.3
300 0.27
301 0.23
302 0.19
303 0.15
304 0.14
305 0.17
306 0.16
307 0.15
308 0.14
309 0.14
310 0.21
311 0.26
312 0.27
313 0.3
314 0.32
315 0.31
316 0.35
317 0.4
318 0.37
319 0.32
320 0.33
321 0.34
322 0.36
323 0.43
324 0.43
325 0.39
326 0.39
327 0.41
328 0.43
329 0.42
330 0.38
331 0.37
332 0.37
333 0.38
334 0.38
335 0.36
336 0.31
337 0.25
338 0.27
339 0.24
340 0.19
341 0.18
342 0.17
343 0.15
344 0.15
345 0.14
346 0.11
347 0.08
348 0.09
349 0.09
350 0.09
351 0.09
352 0.08
353 0.09
354 0.09
355 0.08
356 0.08
357 0.08
358 0.1
359 0.1
360 0.11
361 0.11
362 0.19
363 0.25
364 0.25
365 0.26
366 0.3
367 0.32
368 0.39
369 0.43
370 0.41
371 0.45
372 0.54
373 0.62
374 0.67
375 0.72
376 0.74
377 0.76
378 0.81
379 0.77
380 0.74
381 0.72
382 0.67
383 0.66
384 0.64
385 0.64
386 0.57
387 0.59
388 0.61
389 0.64
390 0.68
391 0.71
392 0.74
393 0.72
394 0.72
395 0.69
396 0.7
397 0.64