Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4Z0J8

Protein Details
Accession A0A4Q4Z0J8    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
69-119HETRASPTSRWKREKRPKTRRNNTKAVEKLYQKKRRLKKQAAKLRNTKKTDHydrophilic
NLS Segment(s)
PositionSequence
77-117SRWKREKRPKTRRNNTKAVEKLYQKKRRLKKQAAKLRNTKK
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MPATTRSAWKRSTSNGGAANLRGSEEGGPQASDPAPGADPDSVSGVDPDVASGNDPGFATPTGPPQTSHETRASPTSRWKREKRPKTRRNNTKAVEKLYQKKRRLKKQAAKLRNTKKTDGSAAEEEEEEEEGAGQFSDSDFQHDLPAAEVKHSSLARSVYDISSCGGEVPSCLDILQDEYLVGHGGSSILKSSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.5
3 0.5
4 0.46
5 0.42
6 0.38
7 0.29
8 0.26
9 0.19
10 0.15
11 0.13
12 0.12
13 0.14
14 0.12
15 0.12
16 0.12
17 0.14
18 0.13
19 0.12
20 0.11
21 0.11
22 0.11
23 0.1
24 0.12
25 0.1
26 0.1
27 0.11
28 0.12
29 0.1
30 0.1
31 0.1
32 0.08
33 0.08
34 0.08
35 0.08
36 0.07
37 0.06
38 0.07
39 0.08
40 0.07
41 0.08
42 0.08
43 0.07
44 0.08
45 0.08
46 0.09
47 0.09
48 0.14
49 0.16
50 0.17
51 0.18
52 0.2
53 0.28
54 0.29
55 0.32
56 0.3
57 0.29
58 0.29
59 0.35
60 0.33
61 0.27
62 0.35
63 0.41
64 0.48
65 0.56
66 0.62
67 0.66
68 0.75
69 0.84
70 0.85
71 0.87
72 0.88
73 0.9
74 0.94
75 0.93
76 0.9
77 0.89
78 0.81
79 0.79
80 0.73
81 0.66
82 0.61
83 0.56
84 0.57
85 0.58
86 0.63
87 0.62
88 0.67
89 0.71
90 0.76
91 0.81
92 0.83
93 0.81
94 0.83
95 0.86
96 0.86
97 0.85
98 0.84
99 0.84
100 0.82
101 0.77
102 0.7
103 0.63
104 0.56
105 0.52
106 0.45
107 0.4
108 0.32
109 0.29
110 0.27
111 0.23
112 0.2
113 0.16
114 0.14
115 0.08
116 0.06
117 0.05
118 0.05
119 0.05
120 0.04
121 0.04
122 0.03
123 0.03
124 0.06
125 0.06
126 0.1
127 0.11
128 0.11
129 0.12
130 0.13
131 0.13
132 0.12
133 0.15
134 0.12
135 0.12
136 0.12
137 0.12
138 0.17
139 0.17
140 0.16
141 0.16
142 0.17
143 0.17
144 0.19
145 0.21
146 0.17
147 0.17
148 0.17
149 0.15
150 0.14
151 0.13
152 0.11
153 0.09
154 0.08
155 0.08
156 0.1
157 0.1
158 0.1
159 0.09
160 0.09
161 0.09
162 0.12
163 0.13
164 0.1
165 0.09
166 0.09
167 0.1
168 0.1
169 0.09
170 0.06
171 0.05
172 0.06
173 0.06
174 0.07