Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4YZW7

Protein Details
Accession A0A4Q4YZW7    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-30APTASSGAKKQKKKWSKGKVKDKAQHAVMHydrophilic
NLS Segment(s)
PositionSequence
9-24AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 21, pero 3, mito 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPTASSGAKKQKKKWSKGKVKDKAQHAVMLDKTTSDKLYKDVQSYRLVTVATLVDRLKINGSLARRCLKDLEEKGQIKPVVTHSKMKIYTRAVGASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.86
4 0.88
5 0.91
6 0.93
7 0.92
8 0.92
9 0.89
10 0.85
11 0.81
12 0.72
13 0.65
14 0.55
15 0.5
16 0.4
17 0.34
18 0.27
19 0.2
20 0.2
21 0.17
22 0.17
23 0.13
24 0.12
25 0.13
26 0.2
27 0.21
28 0.24
29 0.26
30 0.28
31 0.31
32 0.32
33 0.29
34 0.24
35 0.22
36 0.17
37 0.16
38 0.13
39 0.08
40 0.09
41 0.08
42 0.09
43 0.09
44 0.1
45 0.09
46 0.09
47 0.1
48 0.12
49 0.15
50 0.17
51 0.21
52 0.26
53 0.26
54 0.27
55 0.28
56 0.27
57 0.33
58 0.35
59 0.37
60 0.41
61 0.42
62 0.42
63 0.47
64 0.46
65 0.37
66 0.34
67 0.36
68 0.36
69 0.38
70 0.44
71 0.4
72 0.48
73 0.52
74 0.53
75 0.53
76 0.48
77 0.5
78 0.46