Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8LPX5

Protein Details
Accession J8LPX5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
332-354SKLPPFMRKLKKYHLEHHYKNYQHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, E.R. 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
IPR018506  Cyt_B5_heme-BS  
IPR006694  Fatty_acid_hydroxylase  
IPR014430  Scs7  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0080132  F:fatty acid alpha-hydroxylase activity  
GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0006633  P:fatty acid biosynthetic process  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
PF04116  FA_hydroxylase  
PROSITE View protein in PROSITE  
PS00191  CYTOCHROME_B5_1  
PS50255  CYTOCHROME_B5_2  
Amino Acid Sequences MSTNTSKTLELFSKKTVEEHNTAKNCWVTYQNRKIYDVTKFLSEHPGGDEYILDYAGKDITEIMKDSDVHEHSDPAYEILDDEYLVGYLATEEEATRLLTNKNHKVEVQLSADGTQFDSTTFVKNLPAEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAPLFGNFLEPLTKTAWWVVPIAWVPVVLYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDDVFGTYLGPDAPLSKMKYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.44
4 0.43
5 0.43
6 0.46
7 0.52
8 0.5
9 0.51
10 0.52
11 0.48
12 0.42
13 0.39
14 0.41
15 0.4
16 0.47
17 0.56
18 0.59
19 0.59
20 0.62
21 0.62
22 0.59
23 0.57
24 0.53
25 0.45
26 0.42
27 0.4
28 0.39
29 0.44
30 0.39
31 0.32
32 0.29
33 0.28
34 0.23
35 0.22
36 0.2
37 0.13
38 0.13
39 0.12
40 0.09
41 0.07
42 0.07
43 0.08
44 0.07
45 0.06
46 0.07
47 0.09
48 0.1
49 0.12
50 0.12
51 0.14
52 0.15
53 0.17
54 0.23
55 0.22
56 0.24
57 0.24
58 0.24
59 0.21
60 0.24
61 0.22
62 0.16
63 0.15
64 0.11
65 0.11
66 0.1
67 0.1
68 0.07
69 0.07
70 0.06
71 0.06
72 0.06
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.06
83 0.07
84 0.09
85 0.11
86 0.16
87 0.25
88 0.33
89 0.36
90 0.37
91 0.37
92 0.4
93 0.4
94 0.41
95 0.36
96 0.29
97 0.26
98 0.25
99 0.25
100 0.21
101 0.18
102 0.13
103 0.09
104 0.08
105 0.1
106 0.09
107 0.12
108 0.12
109 0.12
110 0.14
111 0.14
112 0.16
113 0.16
114 0.18
115 0.17
116 0.16
117 0.16
118 0.14
119 0.15
120 0.13
121 0.11
122 0.09
123 0.08
124 0.1
125 0.13
126 0.16
127 0.17
128 0.2
129 0.23
130 0.26
131 0.27
132 0.27
133 0.3
134 0.35
135 0.45
136 0.51
137 0.51
138 0.49
139 0.48
140 0.44
141 0.4
142 0.32
143 0.22
144 0.15
145 0.15
146 0.16
147 0.16
148 0.2
149 0.18
150 0.2
151 0.21
152 0.2
153 0.18
154 0.21
155 0.28
156 0.26
157 0.35
158 0.41
159 0.42
160 0.42
161 0.43
162 0.41
163 0.39
164 0.4
165 0.34
166 0.28
167 0.34
168 0.34
169 0.33
170 0.31
171 0.25
172 0.24
173 0.2
174 0.19
175 0.09
176 0.09
177 0.07
178 0.07
179 0.08
180 0.09
181 0.09
182 0.08
183 0.1
184 0.1
185 0.1
186 0.11
187 0.09
188 0.1
189 0.1
190 0.11
191 0.09
192 0.08
193 0.07
194 0.07
195 0.07
196 0.05
197 0.05
198 0.04
199 0.05
200 0.05
201 0.05
202 0.06
203 0.06
204 0.07
205 0.1
206 0.1
207 0.1
208 0.09
209 0.1
210 0.11
211 0.1
212 0.1
213 0.07
214 0.07
215 0.07
216 0.07
217 0.08
218 0.06
219 0.06
220 0.06
221 0.06
222 0.06
223 0.06
224 0.06
225 0.05
226 0.05
227 0.05
228 0.07
229 0.1
230 0.1
231 0.1
232 0.1
233 0.12
234 0.15
235 0.15
236 0.15
237 0.12
238 0.15
239 0.17
240 0.19
241 0.18
242 0.15
243 0.15
244 0.14
245 0.14
246 0.12
247 0.1
248 0.08
249 0.09
250 0.09
251 0.09
252 0.09
253 0.09
254 0.09
255 0.12
256 0.14
257 0.12
258 0.12
259 0.13
260 0.17
261 0.2
262 0.26
263 0.28
264 0.25
265 0.26
266 0.28
267 0.31
268 0.29
269 0.3
270 0.23
271 0.22
272 0.23
273 0.23
274 0.21
275 0.17
276 0.17
277 0.14
278 0.14
279 0.13
280 0.12
281 0.12
282 0.12
283 0.13
284 0.1
285 0.11
286 0.1
287 0.1
288 0.11
289 0.1
290 0.11
291 0.1
292 0.1
293 0.09
294 0.09
295 0.08
296 0.06
297 0.07
298 0.05
299 0.05
300 0.05
301 0.05
302 0.05
303 0.04
304 0.04
305 0.05
306 0.05
307 0.05
308 0.07
309 0.09
310 0.1
311 0.1
312 0.13
313 0.13
314 0.16
315 0.22
316 0.26
317 0.3
318 0.35
319 0.37
320 0.42
321 0.48
322 0.53
323 0.54
324 0.58
325 0.64
326 0.65
327 0.72
328 0.74
329 0.78
330 0.77
331 0.8
332 0.8
333 0.8
334 0.79
335 0.81
336 0.79
337 0.72
338 0.7
339 0.61
340 0.52
341 0.42
342 0.36
343 0.28
344 0.2
345 0.2
346 0.15
347 0.15
348 0.16
349 0.16
350 0.14
351 0.13
352 0.13
353 0.12
354 0.15
355 0.13
356 0.11
357 0.11
358 0.12
359 0.11
360 0.11
361 0.09
362 0.08
363 0.11
364 0.17