Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8PX88

Protein Details
Accession J8PX88   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
230-253SVSSKRHSRTKHFKKNGHVRRHDFBasic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 13.333, cyto 6.5, cyto_pero 4.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR026231  IBD2  
Gene Ontology GO:0000922  C:spindle pole  
GO:0007094  P:mitotic spindle assembly checkpoint signaling  
Amino Acid Sequences MTSTNQPSGTTNASIELVSEDGPMPINVMMQEGVKALTKILSNQLQDRQAFQNAPHAMQFIIRNGGKALSNARLEELKDVLPKMDSLSLEDELAKIDNQSTYHIDSAEEKETFGKKLDQITTPNNTDFVIDHDLQKILDDDLKDPELNLNGEEAEIIFDYESQELDTPDGIGEKISQMIESVLPGGFGNEEQGRLRAVMNVDDLDVAEEVTEIDHNDADTARLHGDIQHSVSSKRHSRTKHFKKNGHVRRHDFYNESRDHKRCCPHHHYENISKLRNYYYHDFDYIPKTDNSLPDFSVLVNESKPMCLFCEYYMVFGEPPRNMIKWYNRTFGYNRMPNPPRDEQDSRKRNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.15
4 0.12
5 0.11
6 0.11
7 0.1
8 0.09
9 0.11
10 0.1
11 0.1
12 0.09
13 0.1
14 0.09
15 0.1
16 0.1
17 0.09
18 0.1
19 0.09
20 0.1
21 0.11
22 0.11
23 0.1
24 0.12
25 0.13
26 0.14
27 0.21
28 0.26
29 0.27
30 0.32
31 0.38
32 0.41
33 0.41
34 0.43
35 0.4
36 0.38
37 0.37
38 0.33
39 0.36
40 0.31
41 0.32
42 0.28
43 0.25
44 0.21
45 0.22
46 0.23
47 0.17
48 0.22
49 0.21
50 0.21
51 0.21
52 0.23
53 0.2
54 0.2
55 0.22
56 0.2
57 0.22
58 0.21
59 0.23
60 0.23
61 0.23
62 0.23
63 0.21
64 0.18
65 0.19
66 0.19
67 0.18
68 0.16
69 0.16
70 0.15
71 0.17
72 0.14
73 0.14
74 0.17
75 0.17
76 0.17
77 0.17
78 0.15
79 0.12
80 0.13
81 0.1
82 0.07
83 0.08
84 0.09
85 0.09
86 0.12
87 0.14
88 0.15
89 0.16
90 0.16
91 0.16
92 0.17
93 0.2
94 0.21
95 0.19
96 0.17
97 0.2
98 0.21
99 0.21
100 0.2
101 0.2
102 0.18
103 0.24
104 0.27
105 0.26
106 0.29
107 0.33
108 0.37
109 0.36
110 0.34
111 0.29
112 0.26
113 0.23
114 0.19
115 0.17
116 0.17
117 0.15
118 0.16
119 0.16
120 0.17
121 0.16
122 0.16
123 0.13
124 0.08
125 0.1
126 0.1
127 0.1
128 0.12
129 0.13
130 0.13
131 0.12
132 0.12
133 0.12
134 0.11
135 0.1
136 0.08
137 0.07
138 0.07
139 0.07
140 0.06
141 0.05
142 0.04
143 0.04
144 0.03
145 0.04
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.06
153 0.06
154 0.05
155 0.05
156 0.05
157 0.05
158 0.04
159 0.04
160 0.04
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.06
169 0.04
170 0.05
171 0.05
172 0.05
173 0.04
174 0.04
175 0.06
176 0.06
177 0.07
178 0.07
179 0.08
180 0.08
181 0.09
182 0.09
183 0.09
184 0.09
185 0.09
186 0.1
187 0.1
188 0.09
189 0.09
190 0.08
191 0.07
192 0.06
193 0.05
194 0.04
195 0.04
196 0.03
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.04
203 0.05
204 0.05
205 0.06
206 0.06
207 0.07
208 0.07
209 0.07
210 0.07
211 0.09
212 0.11
213 0.12
214 0.13
215 0.15
216 0.16
217 0.17
218 0.2
219 0.24
220 0.28
221 0.32
222 0.37
223 0.4
224 0.49
225 0.59
226 0.68
227 0.74
228 0.77
229 0.78
230 0.82
231 0.88
232 0.87
233 0.87
234 0.85
235 0.8
236 0.75
237 0.74
238 0.67
239 0.6
240 0.55
241 0.54
242 0.5
243 0.49
244 0.52
245 0.51
246 0.53
247 0.56
248 0.6
249 0.58
250 0.62
251 0.65
252 0.67
253 0.71
254 0.74
255 0.75
256 0.75
257 0.77
258 0.75
259 0.71
260 0.62
261 0.55
262 0.5
263 0.46
264 0.43
265 0.39
266 0.37
267 0.36
268 0.37
269 0.36
270 0.36
271 0.38
272 0.34
273 0.32
274 0.25
275 0.26
276 0.27
277 0.3
278 0.31
279 0.28
280 0.27
281 0.25
282 0.25
283 0.21
284 0.21
285 0.18
286 0.15
287 0.13
288 0.15
289 0.15
290 0.16
291 0.16
292 0.14
293 0.15
294 0.16
295 0.17
296 0.16
297 0.23
298 0.22
299 0.23
300 0.24
301 0.23
302 0.2
303 0.21
304 0.26
305 0.18
306 0.21
307 0.23
308 0.23
309 0.24
310 0.32
311 0.4
312 0.45
313 0.51
314 0.53
315 0.52
316 0.56
317 0.56
318 0.58
319 0.58
320 0.56
321 0.54
322 0.58
323 0.62
324 0.62
325 0.67
326 0.66
327 0.6
328 0.61
329 0.65
330 0.64
331 0.7