Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4YPZ2

Protein Details
Accession A0A4Q4YPZ2   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
152-177ARGVATRRAGRRRREKARCGERLFQAHydrophilic
NLS Segment(s)
PositionSequence
134-169RAGAAAAADPRRRLSVQRARGVATRRAGRRRREKAR
Subcellular Location(s) cyto 11, nucl 8, pero 6
Family & Domain DBs
Amino Acid Sequences MGVSYSHTRAEPGRSTESVHLEIYGYRSWNHIPFYYIVREWRAIAMAFYGKPIASGTPLDLNWDWQIKYKIGRVKPAFILLCPTFMKRVRSLVVHIRYPAHMLDDSDLSRYPGFSRVRAWKQVRAPTPPQLKWRAGAAAAADPRRRLSVQRARGVATRRAGRRRREKARCGERLFQALRRFKVRKTEWWCTRLNATRCRLLILTAILKDNIPML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.4
3 0.42
4 0.44
5 0.4
6 0.34
7 0.29
8 0.24
9 0.24
10 0.23
11 0.21
12 0.17
13 0.15
14 0.17
15 0.2
16 0.23
17 0.25
18 0.23
19 0.23
20 0.24
21 0.27
22 0.29
23 0.28
24 0.27
25 0.28
26 0.28
27 0.26
28 0.25
29 0.22
30 0.18
31 0.16
32 0.15
33 0.14
34 0.13
35 0.13
36 0.12
37 0.11
38 0.11
39 0.11
40 0.09
41 0.08
42 0.09
43 0.1
44 0.13
45 0.13
46 0.17
47 0.16
48 0.18
49 0.18
50 0.2
51 0.19
52 0.2
53 0.22
54 0.2
55 0.23
56 0.27
57 0.32
58 0.32
59 0.41
60 0.39
61 0.41
62 0.4
63 0.43
64 0.38
65 0.3
66 0.34
67 0.24
68 0.25
69 0.22
70 0.21
71 0.2
72 0.22
73 0.26
74 0.21
75 0.24
76 0.23
77 0.24
78 0.26
79 0.31
80 0.31
81 0.3
82 0.29
83 0.27
84 0.25
85 0.25
86 0.22
87 0.15
88 0.11
89 0.1
90 0.1
91 0.1
92 0.1
93 0.1
94 0.1
95 0.09
96 0.09
97 0.09
98 0.08
99 0.14
100 0.15
101 0.15
102 0.2
103 0.28
104 0.32
105 0.41
106 0.43
107 0.43
108 0.48
109 0.54
110 0.53
111 0.51
112 0.51
113 0.5
114 0.55
115 0.53
116 0.53
117 0.51
118 0.49
119 0.43
120 0.41
121 0.34
122 0.26
123 0.23
124 0.18
125 0.16
126 0.18
127 0.2
128 0.2
129 0.19
130 0.2
131 0.21
132 0.21
133 0.2
134 0.27
135 0.34
136 0.42
137 0.47
138 0.48
139 0.47
140 0.51
141 0.53
142 0.48
143 0.45
144 0.44
145 0.45
146 0.54
147 0.59
148 0.64
149 0.71
150 0.75
151 0.8
152 0.83
153 0.85
154 0.86
155 0.89
156 0.89
157 0.84
158 0.81
159 0.74
160 0.72
161 0.66
162 0.61
163 0.6
164 0.57
165 0.55
166 0.57
167 0.56
168 0.51
169 0.59
170 0.58
171 0.59
172 0.61
173 0.68
174 0.68
175 0.7
176 0.69
177 0.62
178 0.66
179 0.65
180 0.64
181 0.62
182 0.58
183 0.6
184 0.57
185 0.57
186 0.48
187 0.4
188 0.36
189 0.32
190 0.32
191 0.27
192 0.28
193 0.25
194 0.25