Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4YG71

Protein Details
Accession A0A4Q4YG71    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
64-92YMKAKRRVPASQRKRTQTRLGRPFRDNNHHydrophilic
NLS Segment(s)
PositionSequence
68-77KRRVPASQRK
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MAPGQQLPLPPIPQDGLSHIVPVQMPATSHHGLTLPPSGGPPSAFVPQSPVVGDLTPSQQHKEYMKAKRRVPASQRKRTQTRLGRPFRDNNHITLLDLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.2
4 0.19
5 0.19
6 0.17
7 0.17
8 0.16
9 0.15
10 0.13
11 0.09
12 0.09
13 0.11
14 0.17
15 0.16
16 0.16
17 0.16
18 0.16
19 0.15
20 0.17
21 0.17
22 0.11
23 0.1
24 0.11
25 0.11
26 0.11
27 0.11
28 0.11
29 0.1
30 0.12
31 0.12
32 0.12
33 0.15
34 0.15
35 0.15
36 0.14
37 0.12
38 0.1
39 0.1
40 0.11
41 0.08
42 0.09
43 0.12
44 0.12
45 0.13
46 0.14
47 0.17
48 0.18
49 0.25
50 0.31
51 0.39
52 0.48
53 0.54
54 0.57
55 0.6
56 0.63
57 0.64
58 0.65
59 0.66
60 0.67
61 0.7
62 0.75
63 0.79
64 0.82
65 0.8
66 0.8
67 0.8
68 0.8
69 0.8
70 0.81
71 0.79
72 0.78
73 0.8
74 0.76
75 0.76
76 0.67
77 0.59
78 0.57
79 0.5