Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4X6E3

Protein Details
Accession A0A4Q4X6E3    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
27-48KVTLATPKKSAKKPRKLPSTSTHydrophilic
NLS Segment(s)
PositionSequence
32-45TPKKSAKKPRKLPS
Subcellular Location(s) nucl 18, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MSAAVVGDGAPPPGGRKPPRQDLPADKVTLATPKKSAKKPRKLPSTSTLRASGNKRAPQTPKQAAKDDNNCVYTGSSYNSVPIANGIVMTGEKPAAEKTNYDPIYIGDSTSSDYDDSGSAPENNNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.37
4 0.45
5 0.55
6 0.62
7 0.63
8 0.66
9 0.66
10 0.68
11 0.64
12 0.57
13 0.46
14 0.4
15 0.38
16 0.38
17 0.31
18 0.25
19 0.24
20 0.31
21 0.39
22 0.47
23 0.57
24 0.6
25 0.69
26 0.77
27 0.82
28 0.85
29 0.81
30 0.79
31 0.77
32 0.76
33 0.68
34 0.61
35 0.54
36 0.45
37 0.46
38 0.43
39 0.43
40 0.4
41 0.42
42 0.41
43 0.43
44 0.47
45 0.47
46 0.53
47 0.53
48 0.53
49 0.52
50 0.54
51 0.53
52 0.54
53 0.54
54 0.49
55 0.44
56 0.38
57 0.34
58 0.31
59 0.27
60 0.21
61 0.16
62 0.13
63 0.11
64 0.1
65 0.11
66 0.11
67 0.1
68 0.09
69 0.09
70 0.08
71 0.06
72 0.06
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.07
82 0.11
83 0.12
84 0.13
85 0.17
86 0.27
87 0.28
88 0.28
89 0.27
90 0.24
91 0.29
92 0.27
93 0.23
94 0.13
95 0.13
96 0.15
97 0.15
98 0.15
99 0.09
100 0.1
101 0.1
102 0.1
103 0.1
104 0.1
105 0.12
106 0.13