Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1XQY5

Protein Details
Accession A0A4V1XQY5   
Localization Confidence High
Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
21-43GGDREQHRPNAKRQKKNEKYGFGBasic
NLS Segment(s)
PositionSequence
24-51REQHRPNAKRQKKNEKYGFGGKKRHAKS
65-95ARRMKTGARAKVPKTARLGKSRRKAAGAGKR
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008610  Ebp2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF05890  Ebp2  
Amino Acid Sequences MQRKANLRLNQNSKASSGRNGGDREQHRPNAKRQKKNEKYGFGGKKRHAKSGDAVSTGDMSGFSARRMKTGARAKVPKTARLGKSRRKAAGAGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.45
3 0.4
4 0.37
5 0.32
6 0.33
7 0.35
8 0.34
9 0.39
10 0.39
11 0.41
12 0.43
13 0.47
14 0.5
15 0.51
16 0.59
17 0.62
18 0.69
19 0.72
20 0.75
21 0.8
22 0.81
23 0.88
24 0.86
25 0.8
26 0.76
27 0.76
28 0.75
29 0.7
30 0.68
31 0.62
32 0.63
33 0.59
34 0.6
35 0.52
36 0.45
37 0.42
38 0.44
39 0.42
40 0.33
41 0.32
42 0.25
43 0.24
44 0.22
45 0.17
46 0.09
47 0.06
48 0.07
49 0.07
50 0.08
51 0.13
52 0.13
53 0.14
54 0.16
55 0.17
56 0.25
57 0.34
58 0.4
59 0.45
60 0.52
61 0.53
62 0.6
63 0.62
64 0.59
65 0.57
66 0.59
67 0.57
68 0.6
69 0.68
70 0.69
71 0.76
72 0.79
73 0.76
74 0.7
75 0.68