Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8Q210

Protein Details
Accession J8Q210    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
96-117LEIFRKKCIKDNKKLHQWNKLTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto 4, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002775  DNA/RNA-bd_Alba-like  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF01918  Alba  
Amino Acid Sequences MIKSVYYNETNANLDLNSCGQCLRFLQETIIPSLANDSNNSSSIQYHGISKNDNIKQSINKLDKQTTAAAGNSGKQQQVLCVFSYGPHIQKMLSILEIFRKKCIKDNKKLHQWNKLTSFDITKEGRNELLDKKLKVPILITFISDSEITDLNLHLFTKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.14
5 0.12
6 0.13
7 0.12
8 0.13
9 0.14
10 0.17
11 0.17
12 0.17
13 0.19
14 0.22
15 0.23
16 0.24
17 0.24
18 0.19
19 0.16
20 0.19
21 0.18
22 0.16
23 0.15
24 0.16
25 0.17
26 0.18
27 0.19
28 0.16
29 0.15
30 0.15
31 0.17
32 0.13
33 0.16
34 0.18
35 0.19
36 0.2
37 0.23
38 0.3
39 0.31
40 0.33
41 0.3
42 0.3
43 0.32
44 0.35
45 0.41
46 0.36
47 0.36
48 0.38
49 0.38
50 0.37
51 0.36
52 0.33
53 0.25
54 0.22
55 0.18
56 0.16
57 0.14
58 0.14
59 0.14
60 0.14
61 0.12
62 0.12
63 0.12
64 0.12
65 0.14
66 0.14
67 0.12
68 0.12
69 0.11
70 0.11
71 0.15
72 0.15
73 0.13
74 0.13
75 0.13
76 0.12
77 0.13
78 0.14
79 0.1
80 0.09
81 0.08
82 0.08
83 0.15
84 0.2
85 0.2
86 0.23
87 0.26
88 0.26
89 0.34
90 0.44
91 0.47
92 0.53
93 0.63
94 0.69
95 0.77
96 0.86
97 0.85
98 0.83
99 0.79
100 0.76
101 0.72
102 0.65
103 0.56
104 0.48
105 0.45
106 0.36
107 0.37
108 0.31
109 0.28
110 0.27
111 0.26
112 0.26
113 0.25
114 0.27
115 0.24
116 0.32
117 0.35
118 0.34
119 0.36
120 0.39
121 0.39
122 0.36
123 0.34
124 0.29
125 0.28
126 0.27
127 0.25
128 0.21
129 0.2
130 0.21
131 0.19
132 0.16
133 0.12
134 0.13
135 0.12
136 0.12
137 0.12
138 0.11
139 0.13