Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8PYN2

Protein Details
Accession J8PYN2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
148-171GPQLSTKKPRPPIKSKPKHLQGGTHydrophilic
NLS Segment(s)
PositionSequence
154-165KKPRPPIKSKPK
Subcellular Location(s) cyto_nucl 12.833, nucl 12.5, cyto 11, mito_nucl 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR001715  CH_dom  
IPR036872  CH_dom_sf  
IPR003096  SM22_calponin  
Gene Ontology GO:0016043  P:cellular component organization  
Pfam View protein in Pfam  
PF00307  CH  
PROSITE View protein in PROSITE  
PS50021  CH  
Amino Acid Sequences MSYDKKADVTSLDEDLRQLRENKFSPEAVQHIKKWIFESILQEAVPPENLLQCLKDGTVLCKLANTLYEANTKEANHIAWKSSKMPFVQMDQISQFLSFAREYGVPEDELFQTVDLYEEKDPAIVYQTLKSLSRYANKNHPDRFPVLGPQLSTKKPRPPIKSKPKHLQGGTGWSTFEYGYMKGASQGTEGVVLGQRRDIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.25
4 0.24
5 0.26
6 0.25
7 0.32
8 0.35
9 0.4
10 0.41
11 0.39
12 0.38
13 0.37
14 0.4
15 0.41
16 0.43
17 0.38
18 0.43
19 0.44
20 0.43
21 0.4
22 0.37
23 0.31
24 0.29
25 0.32
26 0.27
27 0.28
28 0.26
29 0.24
30 0.22
31 0.2
32 0.18
33 0.13
34 0.1
35 0.09
36 0.1
37 0.11
38 0.1
39 0.1
40 0.1
41 0.1
42 0.13
43 0.12
44 0.13
45 0.18
46 0.18
47 0.18
48 0.17
49 0.18
50 0.15
51 0.15
52 0.15
53 0.12
54 0.13
55 0.17
56 0.18
57 0.19
58 0.21
59 0.2
60 0.18
61 0.18
62 0.17
63 0.16
64 0.15
65 0.16
66 0.16
67 0.18
68 0.2
69 0.21
70 0.24
71 0.21
72 0.24
73 0.23
74 0.23
75 0.27
76 0.24
77 0.23
78 0.2
79 0.2
80 0.17
81 0.15
82 0.13
83 0.07
84 0.08
85 0.07
86 0.06
87 0.07
88 0.07
89 0.08
90 0.09
91 0.1
92 0.09
93 0.09
94 0.11
95 0.09
96 0.1
97 0.09
98 0.08
99 0.07
100 0.06
101 0.07
102 0.06
103 0.07
104 0.07
105 0.07
106 0.07
107 0.08
108 0.08
109 0.07
110 0.1
111 0.09
112 0.1
113 0.1
114 0.12
115 0.13
116 0.14
117 0.15
118 0.16
119 0.19
120 0.25
121 0.28
122 0.31
123 0.39
124 0.46
125 0.53
126 0.54
127 0.54
128 0.51
129 0.5
130 0.49
131 0.41
132 0.38
133 0.34
134 0.31
135 0.28
136 0.3
137 0.32
138 0.32
139 0.37
140 0.38
141 0.43
142 0.51
143 0.59
144 0.62
145 0.68
146 0.75
147 0.8
148 0.85
149 0.86
150 0.88
151 0.88
152 0.87
153 0.79
154 0.75
155 0.67
156 0.66
157 0.6
158 0.5
159 0.41
160 0.32
161 0.32
162 0.23
163 0.21
164 0.14
165 0.1
166 0.12
167 0.12
168 0.12
169 0.15
170 0.16
171 0.15
172 0.14
173 0.14
174 0.13
175 0.13
176 0.13
177 0.11
178 0.14
179 0.15
180 0.14