Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4WDT9

Protein Details
Accession A0A4Q4WDT9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
52-71ASPRREHSPRRPPPRSPPLABasic
NLS Segment(s)
PositionSequence
57-65EHSPRRPPP
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
Amino Acid Sequences MPAALAESRTSRVRSFSRPWTPTREPLRFEITTPATAAAAAMTTATPASRTASPRREHSPRRPPPRSPPLAVMDRGLRSPGIVGDDFGGGFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.48
4 0.55
5 0.56
6 0.59
7 0.62
8 0.62
9 0.64
10 0.66
11 0.62
12 0.55
13 0.54
14 0.57
15 0.48
16 0.44
17 0.41
18 0.34
19 0.29
20 0.27
21 0.23
22 0.16
23 0.15
24 0.14
25 0.07
26 0.05
27 0.04
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.06
36 0.09
37 0.13
38 0.2
39 0.27
40 0.3
41 0.34
42 0.41
43 0.48
44 0.53
45 0.6
46 0.65
47 0.68
48 0.76
49 0.78
50 0.77
51 0.79
52 0.81
53 0.77
54 0.69
55 0.65
56 0.61
57 0.59
58 0.54
59 0.46
60 0.39
61 0.34
62 0.31
63 0.27
64 0.2
65 0.16
66 0.16
67 0.14
68 0.14
69 0.13
70 0.13
71 0.13
72 0.14