Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8PH74

Protein Details
Accession J8PH74   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-93RRKGRVYIYCKSNKKHKQRQGBasic
NLS Segment(s)
Subcellular Location(s) mito 22.5, mito_nucl 12.5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MFLQTLRLSMPRVLSHMKPSPTTITRAYMLPTLLAVGAQQSGVVAANKSLVFSRGFKIRTSIKKFCSDCYLVRRKGRVYIYCKSNKKHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.34
3 0.38
4 0.38
5 0.36
6 0.38
7 0.4
8 0.38
9 0.4
10 0.34
11 0.31
12 0.29
13 0.29
14 0.27
15 0.22
16 0.2
17 0.15
18 0.13
19 0.1
20 0.08
21 0.07
22 0.05
23 0.04
24 0.04
25 0.04
26 0.03
27 0.03
28 0.03
29 0.04
30 0.04
31 0.04
32 0.04
33 0.06
34 0.06
35 0.06
36 0.06
37 0.07
38 0.08
39 0.1
40 0.12
41 0.16
42 0.18
43 0.18
44 0.22
45 0.28
46 0.37
47 0.44
48 0.48
49 0.47
50 0.55
51 0.56
52 0.55
53 0.54
54 0.48
55 0.44
56 0.48
57 0.53
58 0.51
59 0.56
60 0.58
61 0.54
62 0.58
63 0.6
64 0.59
65 0.57
66 0.58
67 0.62
68 0.67
69 0.72
70 0.71
71 0.74
72 0.76
73 0.8