Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4ZE02

Protein Details
Accession A0A4Q4ZE02   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
37-62QPISLQHAHKRHRQRRHQAAHTHSGSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 6, cyto 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013898  Atg43  
Gene Ontology GO:0140580  F:mitochondrion autophagosome adaptor activity  
GO:0000423  P:mitophagy  
Pfam View protein in Pfam  
PF08589  ATG43  
Amino Acid Sequences MADLSSEIASTIQAGHIKRDPSPRHDLNPSMSASERQPISLQHAHKRHRQRRHQAAHTHSGSEADEEEDDDDVDDDDDEIPLSVLKPRPRGHHRAHSFPPMPDLRFEQSYLHSIAGADKWWKVAWITVRDQVMMPLAQGVLYNLAICGWQHWNRNARIHGNSVGARVRRWWYGVNNWALPPLEPGKAAFSKASLAGRGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.18
3 0.23
4 0.25
5 0.3
6 0.39
7 0.42
8 0.45
9 0.54
10 0.54
11 0.56
12 0.6
13 0.59
14 0.54
15 0.53
16 0.47
17 0.4
18 0.36
19 0.32
20 0.27
21 0.29
22 0.24
23 0.2
24 0.2
25 0.19
26 0.26
27 0.3
28 0.34
29 0.37
30 0.45
31 0.49
32 0.57
33 0.67
34 0.68
35 0.73
36 0.79
37 0.81
38 0.83
39 0.88
40 0.88
41 0.86
42 0.83
43 0.82
44 0.72
45 0.62
46 0.51
47 0.42
48 0.33
49 0.25
50 0.19
51 0.1
52 0.09
53 0.08
54 0.09
55 0.07
56 0.07
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.07
71 0.11
72 0.14
73 0.21
74 0.24
75 0.33
76 0.39
77 0.47
78 0.51
79 0.57
80 0.58
81 0.59
82 0.59
83 0.59
84 0.54
85 0.46
86 0.45
87 0.37
88 0.33
89 0.27
90 0.26
91 0.21
92 0.2
93 0.2
94 0.17
95 0.16
96 0.17
97 0.17
98 0.14
99 0.12
100 0.11
101 0.11
102 0.1
103 0.1
104 0.09
105 0.08
106 0.09
107 0.08
108 0.09
109 0.08
110 0.11
111 0.15
112 0.19
113 0.22
114 0.25
115 0.26
116 0.26
117 0.26
118 0.23
119 0.19
120 0.14
121 0.11
122 0.07
123 0.07
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.05
131 0.05
132 0.05
133 0.05
134 0.07
135 0.12
136 0.17
137 0.22
138 0.29
139 0.36
140 0.4
141 0.47
142 0.5
143 0.5
144 0.48
145 0.47
146 0.44
147 0.42
148 0.38
149 0.35
150 0.36
151 0.31
152 0.28
153 0.28
154 0.29
155 0.26
156 0.28
157 0.3
158 0.3
159 0.38
160 0.45
161 0.47
162 0.46
163 0.44
164 0.44
165 0.39
166 0.34
167 0.3
168 0.25
169 0.21
170 0.19
171 0.2
172 0.23
173 0.24
174 0.26
175 0.21
176 0.19
177 0.2
178 0.24
179 0.25