Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4Z8G8

Protein Details
Accession A0A4Q4Z8G8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
39-60IQKPAPKPKPAPKPTPKPTKRMBasic
NLS Segment(s)
PositionSequence
41-59KPAPKPKPAPKPTPKPTKR
Subcellular Location(s) mito 10, cyto 9, mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MRTTQQFGPGVNMGRGGTDASSPQDGFAYLELQYDTTGIQKPAPKPKPAPKPTPKPTKRMASAKDFDSAGYTTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.13
4 0.1
5 0.09
6 0.09
7 0.1
8 0.12
9 0.12
10 0.11
11 0.11
12 0.11
13 0.1
14 0.1
15 0.09
16 0.07
17 0.08
18 0.07
19 0.07
20 0.07
21 0.06
22 0.06
23 0.06
24 0.08
25 0.07
26 0.1
27 0.14
28 0.19
29 0.29
30 0.34
31 0.37
32 0.43
33 0.52
34 0.61
35 0.64
36 0.7
37 0.7
38 0.76
39 0.81
40 0.85
41 0.81
42 0.76
43 0.77
44 0.76
45 0.74
46 0.73
47 0.7
48 0.68
49 0.67
50 0.62
51 0.58
52 0.48
53 0.4
54 0.34