Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4ZDQ8

Protein Details
Accession A0A4Q4ZDQ8    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-73QAPRQKRRPIREAESKKKAEBasic
NLS Segment(s)
PositionSequence
56-71PRQKRRPIREAESKKK
Subcellular Location(s) nucl 13, cyto_nucl 12.333, cyto 10.5, mito_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MKHTICKYCDTLLVEGHTSTSFVENQSKGGKKPWADVLVVKCNTCGGLKRFPVQAPRQKRRPIREAESKKKAEDDDDAAAPAQVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.23
4 0.17
5 0.14
6 0.13
7 0.12
8 0.1
9 0.11
10 0.16
11 0.16
12 0.18
13 0.24
14 0.26
15 0.25
16 0.29
17 0.32
18 0.28
19 0.31
20 0.34
21 0.3
22 0.28
23 0.31
24 0.31
25 0.34
26 0.34
27 0.31
28 0.25
29 0.22
30 0.22
31 0.19
32 0.18
33 0.14
34 0.2
35 0.22
36 0.25
37 0.27
38 0.29
39 0.36
40 0.4
41 0.46
42 0.5
43 0.57
44 0.63
45 0.69
46 0.76
47 0.76
48 0.77
49 0.76
50 0.74
51 0.76
52 0.78
53 0.8
54 0.81
55 0.76
56 0.69
57 0.64
58 0.57
59 0.5
60 0.44
61 0.38
62 0.33
63 0.31
64 0.3
65 0.26