Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4Z9H0

Protein Details
Accession A0A4Q4Z9H0    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
104-126EKESRKDVGAKPPKRRRGFMRGMBasic
NLS Segment(s)
PositionSequence
90-124GRDKGKYAVNNKDGEKESRKDVGAKPPKRRRGFMR
Subcellular Location(s) cyto 6, mito 5, plas 5, extr 3, pero 3, nucl 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR022703  DUF3533  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF12051  DUF3533  
Amino Acid Sequences MYWMVNLISINAPGIECENMAMVIDQPWTALWVIFWVITNASRQISFDLHSCIGLNLGLLFAWSAVNVALFPLCCYFMSWRSERGQRAAGRDKGKYAVNNKDGEKESRKDVGAKPPKRRRGFMRGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.08
4 0.08
5 0.08
6 0.08
7 0.08
8 0.08
9 0.06
10 0.07
11 0.07
12 0.07
13 0.06
14 0.06
15 0.07
16 0.07
17 0.07
18 0.06
19 0.06
20 0.07
21 0.07
22 0.07
23 0.06
24 0.07
25 0.08
26 0.09
27 0.1
28 0.1
29 0.1
30 0.1
31 0.12
32 0.12
33 0.12
34 0.12
35 0.14
36 0.13
37 0.14
38 0.13
39 0.11
40 0.1
41 0.09
42 0.07
43 0.04
44 0.04
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.05
61 0.06
62 0.07
63 0.1
64 0.14
65 0.18
66 0.19
67 0.23
68 0.26
69 0.32
70 0.33
71 0.34
72 0.37
73 0.35
74 0.41
75 0.46
76 0.48
77 0.47
78 0.46
79 0.45
80 0.41
81 0.42
82 0.4
83 0.39
84 0.41
85 0.42
86 0.46
87 0.45
88 0.49
89 0.48
90 0.49
91 0.48
92 0.42
93 0.42
94 0.42
95 0.42
96 0.41
97 0.43
98 0.48
99 0.52
100 0.58
101 0.64
102 0.7
103 0.79
104 0.8
105 0.83
106 0.81