Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4Z7U3

Protein Details
Accession A0A4Q4Z7U3    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
40-67AVFGTFKMKRNPRKLKWTKAFRKAAGKEHydrophilic
NLS Segment(s)
PositionSequence
47-63MKRNPRKLKWTKAFRKA
105-129RARRERVFYKRRMAGKRARELAEAR
Subcellular Location(s) mito 22.5, cyto_mito 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MPRPSGSAGQSAIRTYVNRRLIFVFVYDFHVPFTTRLSLAVFGTFKMKRNPRKLKWTKAFRKAAGKEMVVDSTLQFAARRNVPVRYNRDLVQKTLKAMERISEIRARRERVFYKRRMAGKRARELAEARRLVNTHSHLLPRLRGSEKRRLANLARERGEELNVEELQKLEQQEVIAQKSSANQVFGKEKQRLRVRVDGDVEAVGADAGGAAGEMDVDWESE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.32
4 0.37
5 0.36
6 0.37
7 0.38
8 0.37
9 0.36
10 0.33
11 0.26
12 0.19
13 0.24
14 0.23
15 0.21
16 0.2
17 0.2
18 0.2
19 0.18
20 0.2
21 0.17
22 0.15
23 0.16
24 0.16
25 0.17
26 0.16
27 0.19
28 0.15
29 0.14
30 0.2
31 0.21
32 0.23
33 0.3
34 0.39
35 0.45
36 0.56
37 0.67
38 0.69
39 0.78
40 0.84
41 0.86
42 0.87
43 0.89
44 0.88
45 0.87
46 0.87
47 0.81
48 0.82
49 0.73
50 0.71
51 0.64
52 0.54
53 0.46
54 0.39
55 0.35
56 0.25
57 0.22
58 0.14
59 0.11
60 0.11
61 0.09
62 0.08
63 0.09
64 0.13
65 0.15
66 0.19
67 0.19
68 0.23
69 0.28
70 0.35
71 0.4
72 0.41
73 0.42
74 0.4
75 0.47
76 0.44
77 0.42
78 0.42
79 0.37
80 0.33
81 0.35
82 0.34
83 0.27
84 0.26
85 0.24
86 0.2
87 0.2
88 0.21
89 0.22
90 0.21
91 0.27
92 0.32
93 0.34
94 0.32
95 0.37
96 0.41
97 0.45
98 0.53
99 0.51
100 0.53
101 0.56
102 0.62
103 0.61
104 0.61
105 0.6
106 0.6
107 0.62
108 0.59
109 0.54
110 0.49
111 0.47
112 0.47
113 0.47
114 0.4
115 0.33
116 0.3
117 0.28
118 0.27
119 0.29
120 0.25
121 0.2
122 0.2
123 0.21
124 0.23
125 0.24
126 0.26
127 0.23
128 0.25
129 0.26
130 0.31
131 0.36
132 0.43
133 0.48
134 0.5
135 0.5
136 0.51
137 0.5
138 0.53
139 0.56
140 0.54
141 0.49
142 0.46
143 0.46
144 0.42
145 0.39
146 0.3
147 0.23
148 0.19
149 0.17
150 0.17
151 0.14
152 0.14
153 0.14
154 0.15
155 0.14
156 0.1
157 0.11
158 0.11
159 0.14
160 0.18
161 0.19
162 0.18
163 0.17
164 0.17
165 0.19
166 0.24
167 0.22
168 0.21
169 0.19
170 0.22
171 0.29
172 0.34
173 0.39
174 0.41
175 0.43
176 0.5
177 0.59
178 0.61
179 0.62
180 0.65
181 0.61
182 0.6
183 0.61
184 0.52
185 0.44
186 0.37
187 0.31
188 0.22
189 0.18
190 0.1
191 0.06
192 0.05
193 0.03
194 0.03
195 0.02
196 0.02
197 0.02
198 0.02
199 0.02
200 0.02
201 0.04