Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4YK65

Protein Details
Accession A0A4Q4YK65   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
43-72GATPSTKKKGKSKAKKKHDHKDRAEQELRNBasic
NLS Segment(s)
PositionSequence
49-63KKKGKSKAKKKHDHK
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, pero 2
Family & Domain DBs
Amino Acid Sequences MPSASDNPHHQTAGTGGGEDNSPSYALQEYLRADPTVTERCSGATPSTKKKGKSKAKKKHDHKDRAEQELRNFDDVWRDAVTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.16
3 0.13
4 0.13
5 0.13
6 0.12
7 0.11
8 0.07
9 0.07
10 0.06
11 0.07
12 0.07
13 0.08
14 0.08
15 0.11
16 0.12
17 0.13
18 0.15
19 0.14
20 0.13
21 0.13
22 0.17
23 0.19
24 0.18
25 0.17
26 0.15
27 0.16
28 0.17
29 0.17
30 0.15
31 0.17
32 0.2
33 0.27
34 0.36
35 0.39
36 0.43
37 0.5
38 0.59
39 0.63
40 0.7
41 0.75
42 0.77
43 0.84
44 0.9
45 0.93
46 0.93
47 0.93
48 0.92
49 0.89
50 0.9
51 0.85
52 0.84
53 0.81
54 0.74
55 0.69
56 0.67
57 0.62
58 0.53
59 0.47
60 0.38
61 0.39
62 0.35
63 0.32